Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2169364..2170091 | Replicon | chromosome |
| Accession | NZ_CP127316 | ||
| Organism | Escherichia coli strain Ch1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | QRM71_RS10825 | Protein ID | WP_000547555.1 |
| Coordinates | 2169780..2170091 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QRM71_RS10820 | Protein ID | WP_000126294.1 |
| Coordinates | 2169364..2169783 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM71_RS10800 (2164449) | 2164449..2164976 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| QRM71_RS10805 (2165125) | 2165125..2166135 | - | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
| QRM71_RS10810 (2166395) | 2166395..2167852 | + | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| QRM71_RS10815 (2167861) | 2167861..2169285 | + | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
| QRM71_RS10820 (2169364) | 2169364..2169783 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QRM71_RS10825 (2169780) | 2169780..2170091 | - | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QRM71_RS10830 (2170258) | 2170258..2170728 | - | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| QRM71_RS10835 (2170721) | 2170721..2171131 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| QRM71_RS10840 (2171128) | 2171128..2171895 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| QRM71_RS10845 (2171895) | 2171895..2172437 | - | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| QRM71_RS10850 (2172447) | 2172447..2174156 | - | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T284175 WP_000547555.1 NZ_CP127316:c2170091-2169780 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT284175 WP_000126294.1 NZ_CP127316:c2169783-2169364 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|