Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2329815..2330646 Replicon chromosome
Accession NZ_CP127314
Organism Escherichia coli strain C25

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QRM69_RS11100 Protein ID WP_000854814.1
Coordinates 2329815..2330189 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1PWQ3
Locus tag QRM69_RS11105 Protein ID WP_001285586.1
Coordinates 2330278..2330646 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM69_RS11065 (2325219) 2325219..2326439 + 1221 WP_000343765.1 ISL3-like element ISEc53 family transposase -
QRM69_RS11070 (2326496) 2326496..2326969 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
QRM69_RS11075 (2327167) 2327167..2328225 + 1059 WP_001200890.1 FUSC family protein -
QRM69_RS11080 (2328397) 2328397..2328726 + 330 WP_000450409.1 DUF496 family protein -
QRM69_RS11085 (2328827) 2328827..2329183 - 357 WP_000929389.1 EutP/PduV family microcompartment system protein -
QRM69_RS11090 (2329498) 2329498..2329578 - 81 Protein_2152 hypothetical protein -
QRM69_RS11095 (2329624) 2329624..2329818 - 195 WP_000988601.1 DUF5983 family protein -
QRM69_RS11100 (2329815) 2329815..2330189 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QRM69_RS11105 (2330278) 2330278..2330646 - 369 WP_001285586.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QRM69_RS11110 (2330720) 2330720..2330941 - 222 WP_000692323.1 DUF987 domain-containing protein -
QRM69_RS11115 (2331010) 2331010..2331486 - 477 WP_001351157.1 RadC family protein -
QRM69_RS11120 (2331502) 2331502..2331987 - 486 WP_000213703.1 antirestriction protein -
QRM69_RS11125 (2332078) 2332078..2332898 - 821 Protein_2159 DUF932 domain-containing protein -
QRM69_RS11130 (2333119) 2333119..2333529 - 411 WP_000846704.1 hypothetical protein -
QRM69_RS11135 (2333545) 2333545..2334221 - 677 Protein_2161 hypothetical protein -
QRM69_RS11140 (2334357) 2334357..2335426 - 1070 Protein_2162 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 2325219..2326439 1220


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T284142 WP_000854814.1 NZ_CP127314:c2330189-2329815 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13563.41 Da        Isoelectric Point: 5.0468

>AT284142 WP_001285586.1 NZ_CP127314:c2330646-2330278 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB S1PWQ3

References