Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 980199..980998 | Replicon | chromosome |
| Accession | NZ_CP127314 | ||
| Organism | Escherichia coli strain C25 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | Q8FDB4 |
| Locus tag | QRM69_RS04730 | Protein ID | WP_000347252.1 |
| Coordinates | 980199..980663 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | QRM69_RS04735 | Protein ID | WP_001296435.1 |
| Coordinates | 980663..980998 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM69_RS04700 (975200) | 975200..975634 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QRM69_RS04705 (975652) | 975652..976530 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QRM69_RS04710 (976520) | 976520..977299 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QRM69_RS04715 (977310) | 977310..977783 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QRM69_RS04720 (977806) | 977806..979086 | - | 1281 | WP_000681926.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QRM69_RS04725 (979335) | 979335..980144 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QRM69_RS04730 (980199) | 980199..980663 | - | 465 | WP_000347252.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QRM69_RS04735 (980663) | 980663..980998 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QRM69_RS04740 (981147) | 981147..982718 | - | 1572 | WP_001273940.1 | galactarate dehydratase | - |
| QRM69_RS04745 (983093) | 983093..984427 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QRM69_RS04750 (984443) | 984443..985213 | + | 771 | WP_001058223.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17750.11 Da Isoelectric Point: 9.4947
>T284137 WP_000347252.1 NZ_CP127314:c980663-980199 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|