Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 141951..142553 | Replicon | chromosome |
Accession | NZ_CP127314 | ||
Organism | Escherichia coli strain C25 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QRM69_RS00640 | Protein ID | WP_000897302.1 |
Coordinates | 142242..142553 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QRM69_RS00635 | Protein ID | WP_000356397.1 |
Coordinates | 141951..142241 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM69_RS00610 (138024) | 138024..138926 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QRM69_RS00615 (138923) | 138923..139558 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QRM69_RS00620 (139555) | 139555..140484 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
QRM69_RS00625 (140700) | 140700..140918 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
QRM69_RS00630 (141314) | 141314..141592 | - | 279 | WP_001296612.1 | hypothetical protein | - |
QRM69_RS00635 (141951) | 141951..142241 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QRM69_RS00640 (142242) | 142242..142553 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QRM69_RS00645 (142783) | 142783..143691 | + | 909 | WP_001305059.1 | alpha/beta hydrolase | - |
QRM69_RS00650 (143755) | 143755..144696 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QRM69_RS00655 (144741) | 144741..145178 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QRM69_RS00660 (145175) | 145175..146047 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QRM69_RS00665 (146041) | 146041..146640 | - | 600 | WP_001443191.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T284136 WP_000897302.1 NZ_CP127314:c142553-142242 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|