Detailed information of TA system TA284135

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 85670..85939
• Replicon: plasmid pC5103
• Accession: NZ_CP127312
• Organism: Escherichia coli strain C51

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QRM70_RS26840
• Protein ID: WP_001372321.1
• Coordinates: 85814..85939 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	85670..85735 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QRM70_RS26805	81380..81907	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
QRM70_RS26810	81965..82198	+	234	WP_000006003.1	DUF905 family protein	-
QRM70_RS26815	82259..84282	+	2024	Protein_96	ParB/RepB/Spo0J family partition protein	-
QRM70_RS26820	84351..84785	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QRM70_RS26825	84782..85544	+	763	Protein_98	plasmid SOS inhibition protein A	-
-	85513..85737	+	225	NuclAT_0	-	-
-	85513..85737	+	225	NuclAT_0	-	-
-	85513..85737	+	225	NuclAT_0	-	-
-	85513..85737	+	225	NuclAT_0	-	-
QRM70_RS26830	85522..85701	-	180	WP_001309233.1	hypothetical protein	-
-	85670..85735	-	66	-	-	Antitoxin
QRM70_RS26835	85723..85872	+	150	Protein_100	plasmid maintenance protein Mok	-
QRM70_RS26840	85814..85939	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QRM70_RS26845	86258..86554	-	297	Protein_102	hypothetical protein	-
QRM70_RS26850	86854..87150	+	297	WP_001272251.1	hypothetical protein	-
QRM70_RS26855	87261..88082	+	822	WP_001234445.1	DUF932 domain-containing protein	-
QRM70_RS26860	88379..88981	-	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
QRM70_RS26865	89304..89687	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QRM70_RS26870	89881..90552	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
QRM70_RS26875	90689..90916	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T284135 WP_001372321.1 NZ_CP127312:85814-85939 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT284135 NZ_CP127312:c85735-85670 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin