Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 61229..61493 Replicon plasmid pC5102
Accession NZ_CP127310
Organism Escherichia coli strain C51

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag QRM70_RS25350 Protein ID WP_001331364.1
Coordinates 61229..61381 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 61436..61493 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM70_RS25320 (56506) 56506..58674 + 2169 WP_000698358.1 DotA/TraY family protein -
QRM70_RS25325 (58748) 58748..59398 + 651 WP_001178507.1 plasmid IncI1-type surface exclusion protein ExcA -
QRM70_RS25330 (59470) 59470..59679 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
QRM70_RS25335 (60071) 60071..60247 + 177 WP_001054904.1 hypothetical protein -
QRM70_RS25340 (60312) 60312..60407 - 96 WP_001303310.1 DinQ-like type I toxin DqlB -
QRM70_RS25345 (60906) 60906..61157 + 252 WP_001291964.1 hypothetical protein -
QRM70_RS25350 (61229) 61229..61381 - 153 WP_001331364.1 Hok/Gef family protein Toxin
- (61436) 61436..61493 + 58 NuclAT_0 - Antitoxin
- (61436) 61436..61493 + 58 NuclAT_0 - Antitoxin
- (61436) 61436..61493 + 58 NuclAT_0 - Antitoxin
- (61436) 61436..61493 + 58 NuclAT_0 - Antitoxin
QRM70_RS25355 (61673) 61673..62881 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
QRM70_RS25360 (62900) 62900..63969 + 1070 Protein_70 IncI1-type conjugal transfer protein TrbB -
QRM70_RS25365 (63962) 63962..66253 + 2292 WP_285965591.1 F-type conjugative transfer protein TrbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3'')-Ib / aph(6)-Id / aac(3)-IVa / aph(4)-Ia - 1..102363 102363


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T284130 WP_001331364.1 NZ_CP127310:c61381-61229 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT284130 NZ_CP127310:61436-61493 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References