Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 61229..61493 | Replicon | plasmid pC5102 |
| Accession | NZ_CP127310 | ||
| Organism | Escherichia coli strain C51 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | QRM70_RS25350 | Protein ID | WP_001331364.1 |
| Coordinates | 61229..61381 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 61436..61493 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM70_RS25320 (56506) | 56506..58674 | + | 2169 | WP_000698358.1 | DotA/TraY family protein | - |
| QRM70_RS25325 (58748) | 58748..59398 | + | 651 | WP_001178507.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QRM70_RS25330 (59470) | 59470..59679 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QRM70_RS25335 (60071) | 60071..60247 | + | 177 | WP_001054904.1 | hypothetical protein | - |
| QRM70_RS25340 (60312) | 60312..60407 | - | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| QRM70_RS25345 (60906) | 60906..61157 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| QRM70_RS25350 (61229) | 61229..61381 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - (61436) | 61436..61493 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (61436) | 61436..61493 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (61436) | 61436..61493 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (61436) | 61436..61493 | + | 58 | NuclAT_0 | - | Antitoxin |
| QRM70_RS25355 (61673) | 61673..62881 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| QRM70_RS25360 (62900) | 62900..63969 | + | 1070 | Protein_70 | IncI1-type conjugal transfer protein TrbB | - |
| QRM70_RS25365 (63962) | 63962..66253 | + | 2292 | WP_285965591.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3'')-Ib / aph(6)-Id / aac(3)-IVa / aph(4)-Ia | - | 1..102363 | 102363 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T284130 WP_001331364.1 NZ_CP127310:c61381-61229 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT284130 NZ_CP127310:61436-61493 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|