Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4184241..4184461 Replicon chromosome
Accession NZ_CP127306
Organism Escherichia coli strain C51

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag QRM70_RS20395 Protein ID WP_000170965.1
Coordinates 4184354..4184461 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4184241..4184307 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM70_RS20370 4179520..4180914 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
QRM70_RS20375 4181099..4181452 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QRM70_RS20380 4181496..4182191 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QRM70_RS20385 4182349..4182579 - 231 WP_001146442.1 putative cation transport regulator ChaB -
QRM70_RS20390 4182849..4183949 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 4184241..4184307 - 67 - - Antitoxin
QRM70_RS20395 4184354..4184461 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4184774..4184837 - 64 NuclAT_33 - -
- 4184774..4184837 - 64 NuclAT_33 - -
- 4184774..4184837 - 64 NuclAT_33 - -
- 4184774..4184837 - 64 NuclAT_33 - -
- 4184774..4184837 - 64 NuclAT_36 - -
- 4184774..4184837 - 64 NuclAT_36 - -
- 4184774..4184837 - 64 NuclAT_36 - -
- 4184774..4184837 - 64 NuclAT_36 - -
- 4184774..4184837 - 64 NuclAT_39 - -
- 4184774..4184837 - 64 NuclAT_39 - -
- 4184774..4184837 - 64 NuclAT_39 - -
- 4184774..4184837 - 64 NuclAT_39 - -
- 4184774..4184837 - 64 NuclAT_42 - -
- 4184774..4184837 - 64 NuclAT_42 - -
- 4184774..4184837 - 64 NuclAT_42 - -
- 4184774..4184837 - 64 NuclAT_42 - -
- 4184774..4184837 - 64 NuclAT_45 - -
- 4184774..4184837 - 64 NuclAT_45 - -
- 4184774..4184837 - 64 NuclAT_45 - -
- 4184774..4184837 - 64 NuclAT_45 - -
- 4184774..4184837 - 64 NuclAT_48 - -
- 4184774..4184837 - 64 NuclAT_48 - -
- 4184774..4184837 - 64 NuclAT_48 - -
- 4184774..4184837 - 64 NuclAT_48 - -
- 4184775..4184837 - 63 NuclAT_50 - -
- 4184775..4184837 - 63 NuclAT_50 - -
- 4184775..4184837 - 63 NuclAT_50 - -
- 4184775..4184837 - 63 NuclAT_50 - -
- 4184775..4184837 - 63 NuclAT_53 - -
- 4184775..4184837 - 63 NuclAT_53 - -
- 4184775..4184837 - 63 NuclAT_53 - -
- 4184775..4184837 - 63 NuclAT_53 - -
- 4184775..4184837 - 63 NuclAT_56 - -
- 4184775..4184837 - 63 NuclAT_56 - -
- 4184775..4184837 - 63 NuclAT_56 - -
- 4184775..4184837 - 63 NuclAT_56 - -
- 4184776..4184837 - 62 NuclAT_15 - -
- 4184776..4184837 - 62 NuclAT_15 - -
- 4184776..4184837 - 62 NuclAT_15 - -
- 4184776..4184837 - 62 NuclAT_15 - -
- 4184776..4184837 - 62 NuclAT_18 - -
- 4184776..4184837 - 62 NuclAT_18 - -
- 4184776..4184837 - 62 NuclAT_18 - -
- 4184776..4184837 - 62 NuclAT_18 - -
- 4184776..4184837 - 62 NuclAT_21 - -
- 4184776..4184837 - 62 NuclAT_21 - -
- 4184776..4184837 - 62 NuclAT_21 - -
- 4184776..4184837 - 62 NuclAT_21 - -
- 4184776..4184837 - 62 NuclAT_24 - -
- 4184776..4184837 - 62 NuclAT_24 - -
- 4184776..4184837 - 62 NuclAT_24 - -
- 4184776..4184837 - 62 NuclAT_24 - -
- 4184776..4184837 - 62 NuclAT_27 - -
- 4184776..4184837 - 62 NuclAT_27 - -
- 4184776..4184837 - 62 NuclAT_27 - -
- 4184776..4184837 - 62 NuclAT_27 - -
- 4184776..4184837 - 62 NuclAT_30 - -
- 4184776..4184837 - 62 NuclAT_30 - -
- 4184776..4184837 - 62 NuclAT_30 - -
- 4184776..4184837 - 62 NuclAT_30 - -
QRM70_RS20400 4184890..4184997 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4185310..4185375 - 66 NuclAT_32 - -
- 4185310..4185375 - 66 NuclAT_32 - -
- 4185310..4185375 - 66 NuclAT_32 - -
- 4185310..4185375 - 66 NuclAT_32 - -
- 4185310..4185375 - 66 NuclAT_35 - -
- 4185310..4185375 - 66 NuclAT_35 - -
- 4185310..4185375 - 66 NuclAT_35 - -
- 4185310..4185375 - 66 NuclAT_35 - -
- 4185310..4185375 - 66 NuclAT_38 - -
- 4185310..4185375 - 66 NuclAT_38 - -
- 4185310..4185375 - 66 NuclAT_38 - -
- 4185310..4185375 - 66 NuclAT_38 - -
- 4185310..4185375 - 66 NuclAT_41 - -
- 4185310..4185375 - 66 NuclAT_41 - -
- 4185310..4185375 - 66 NuclAT_41 - -
- 4185310..4185375 - 66 NuclAT_41 - -
- 4185310..4185375 - 66 NuclAT_44 - -
- 4185310..4185375 - 66 NuclAT_44 - -
- 4185310..4185375 - 66 NuclAT_44 - -
- 4185310..4185375 - 66 NuclAT_44 - -
- 4185310..4185375 - 66 NuclAT_47 - -
- 4185310..4185375 - 66 NuclAT_47 - -
- 4185310..4185375 - 66 NuclAT_47 - -
- 4185310..4185375 - 66 NuclAT_47 - -
- 4185311..4185377 - 67 NuclAT_49 - -
- 4185311..4185377 - 67 NuclAT_49 - -
- 4185311..4185377 - 67 NuclAT_49 - -
- 4185311..4185377 - 67 NuclAT_49 - -
- 4185311..4185377 - 67 NuclAT_52 - -
- 4185311..4185377 - 67 NuclAT_52 - -
- 4185311..4185377 - 67 NuclAT_52 - -
- 4185311..4185377 - 67 NuclAT_52 - -
- 4185311..4185377 - 67 NuclAT_55 - -
- 4185311..4185377 - 67 NuclAT_55 - -
- 4185311..4185377 - 67 NuclAT_55 - -
- 4185311..4185377 - 67 NuclAT_55 - -
- 4185312..4185375 - 64 NuclAT_14 - -
- 4185312..4185375 - 64 NuclAT_14 - -
- 4185312..4185375 - 64 NuclAT_14 - -
- 4185312..4185375 - 64 NuclAT_14 - -
- 4185312..4185375 - 64 NuclAT_17 - -
- 4185312..4185375 - 64 NuclAT_17 - -
- 4185312..4185375 - 64 NuclAT_17 - -
- 4185312..4185375 - 64 NuclAT_17 - -
- 4185312..4185375 - 64 NuclAT_20 - -
- 4185312..4185375 - 64 NuclAT_20 - -
- 4185312..4185375 - 64 NuclAT_20 - -
- 4185312..4185375 - 64 NuclAT_20 - -
- 4185312..4185375 - 64 NuclAT_23 - -
- 4185312..4185375 - 64 NuclAT_23 - -
- 4185312..4185375 - 64 NuclAT_23 - -
- 4185312..4185375 - 64 NuclAT_23 - -
- 4185312..4185375 - 64 NuclAT_26 - -
- 4185312..4185375 - 64 NuclAT_26 - -
- 4185312..4185375 - 64 NuclAT_26 - -
- 4185312..4185375 - 64 NuclAT_26 - -
- 4185312..4185375 - 64 NuclAT_29 - -
- 4185312..4185375 - 64 NuclAT_29 - -
- 4185312..4185375 - 64 NuclAT_29 - -
- 4185312..4185375 - 64 NuclAT_29 - -
QRM70_RS20405 4185425..4185532 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
QRM70_RS20410 4185681..4186535 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QRM70_RS20415 4186571..4187380 - 810 WP_001257044.1 invasion regulator SirB1 -
QRM70_RS20420 4187384..4187776 - 393 WP_000200392.1 invasion regulator SirB2 -
QRM70_RS20425 4187773..4188606 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T284127 WP_000170965.1 NZ_CP127306:4184354-4184461 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp


Antitoxin


Download         Length: 67 bp

>AT284127 NZ_CP127306:c4184307-4184241 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References