Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 4184241..4184461 | Replicon | chromosome |
Accession | NZ_CP127306 | ||
Organism | Escherichia coli strain C51 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | B7LGX8 |
Locus tag | QRM70_RS20395 | Protein ID | WP_000170965.1 |
Coordinates | 4184354..4184461 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4184241..4184307 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM70_RS20370 | 4179520..4180914 | - | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
QRM70_RS20375 | 4181099..4181452 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
QRM70_RS20380 | 4181496..4182191 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
QRM70_RS20385 | 4182349..4182579 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
QRM70_RS20390 | 4182849..4183949 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
- | 4184241..4184307 | - | 67 | - | - | Antitoxin |
QRM70_RS20395 | 4184354..4184461 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4184774..4184837 | - | 64 | NuclAT_33 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_33 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_33 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_33 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_36 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_36 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_36 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_36 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_39 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_39 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_39 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_39 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_42 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_42 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_42 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_42 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_45 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_45 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_45 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_45 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_48 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_48 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_48 | - | - |
- | 4184774..4184837 | - | 64 | NuclAT_48 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_50 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_50 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_50 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_50 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_53 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_53 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_53 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_53 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_56 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_56 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_56 | - | - |
- | 4184775..4184837 | - | 63 | NuclAT_56 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_15 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_15 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_15 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_15 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_18 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_18 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_18 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_18 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_21 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_21 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_21 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_21 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_24 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_24 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_24 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_24 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_27 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_27 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_27 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_27 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_30 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_30 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_30 | - | - |
- | 4184776..4184837 | - | 62 | NuclAT_30 | - | - |
QRM70_RS20400 | 4184890..4184997 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 4185310..4185375 | - | 66 | NuclAT_32 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_32 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_32 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_32 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_35 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_35 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_35 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_35 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_38 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_38 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_38 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_38 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_41 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_41 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_41 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_41 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_44 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_44 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_44 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_44 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_47 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_47 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_47 | - | - |
- | 4185310..4185375 | - | 66 | NuclAT_47 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_49 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_49 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_49 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_49 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_52 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_52 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_52 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_52 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_55 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_55 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_55 | - | - |
- | 4185311..4185377 | - | 67 | NuclAT_55 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_14 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_14 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_14 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_14 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_17 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_17 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_17 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_17 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_20 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_20 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_20 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_20 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_23 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_23 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_23 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_23 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_26 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_26 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_26 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_26 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_29 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_29 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_29 | - | - |
- | 4185312..4185375 | - | 64 | NuclAT_29 | - | - |
QRM70_RS20405 | 4185425..4185532 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QRM70_RS20410 | 4185681..4186535 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
QRM70_RS20415 | 4186571..4187380 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
QRM70_RS20420 | 4187384..4187776 | - | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
QRM70_RS20425 | 4187773..4188606 | - | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T284127 WP_000170965.1 NZ_CP127306:4184354-4184461 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT284127 NZ_CP127306:c4184307-4184241 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|