Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 570307..571106 | Replicon | chromosome |
| Accession | NZ_CP127303 | ||
| Organism | Escherichia coli strain APEC37 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A161R7C1 |
| Locus tag | QRM68_RS04240 | Protein ID | WP_000347278.1 |
| Coordinates | 570642..571106 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | QRM68_RS04235 | Protein ID | WP_001307405.1 |
| Coordinates | 570307..570642 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM68_RS04220 (566092) | 566092..566862 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| QRM68_RS04225 (566878) | 566878..568212 | - | 1335 | WP_000599633.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QRM68_RS04230 (568587) | 568587..570158 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
| QRM68_RS04235 (570307) | 570307..570642 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QRM68_RS04240 (570642) | 570642..571106 | + | 465 | WP_000347278.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QRM68_RS04245 (571161) | 571161..571970 | - | 810 | WP_000072174.1 | aga operon transcriptional regulator AgaR | - |
| QRM68_RS04250 (572219) | 572219..573499 | + | 1281 | WP_021557243.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QRM68_RS04255 (573522) | 573522..573995 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QRM68_RS04260 (574006) | 574006..574785 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QRM68_RS04265 (574775) | 574775..575653 | + | 879 | WP_021557244.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QRM68_RS04270 (575671) | 575671..576105 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 561546..571106 | 9560 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17866.28 Da Isoelectric Point: 9.6924
>T284091 WP_000347278.1 NZ_CP127303:570642-571106 [Escherichia coli]
MDFPQRVNGWALYTHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYTHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A161R7C1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |