Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 162325..162579 | Replicon | plasmid pAPEC3701 |
| Accession | NZ_CP127301 | ||
| Organism | Escherichia coli strain APEC37 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QRM68_RS00885 | Protein ID | WP_001312851.1 |
| Coordinates | 162430..162579 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 162325..162386 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM68_RS00860 (159075) | 159075..159821 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| QRM68_RS00865 (159880) | 159880..160740 | + | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| QRM68_RS00870 (160843) | 160843..161403 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| QRM68_RS00875 (161539) | 161539..161751 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| QRM68_RS00880 (161997) | 161997..162071 | + | 75 | Protein_175 | endonuclease | - |
| - (162325) | 162325..162386 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (162325) | 162325..162386 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (162325) | 162325..162386 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (162325) | 162325..162386 | - | 62 | NuclAT_1 | - | Antitoxin |
| QRM68_RS00885 (162430) | 162430..162579 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| QRM68_RS00890 (162863) | 162863..163120 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| QRM68_RS00895 (163137) | 163137..163388 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| QRM68_RS00900 (163379) | 163379..163426 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| QRM68_RS00905 (163419) | 163419..163901 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| QRM68_RS00910 (163894) | 163894..164751 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| QRM68_RS00915 (165714) | 165714..165965 | + | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QRM68_RS00920 (165962) | 165962..166249 | + | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QRM68_RS00925 (166353) | 166353..166673 | + | 321 | Protein_184 | serine acetyltransferase | - |
| QRM68_RS00930 (166689) | 166689..167036 | - | 348 | Protein_185 | IS1-like element IS1A family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / vat / iroN / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucB / iucC / iucC / iucD / iutA | 1..192709 | 192709 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T284083 WP_001312851.1 NZ_CP127301:162430-162579 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT284083 NZ_CP127301:c162386-162325 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
