Detailed information of TA system TA284080

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 124223..124492
• Replicon: plasmid pAPEC3701
• Accession: NZ_CP127301
• Organism: Escherichia coli strain APEC37

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QRM68_RS00660
• Protein ID: WP_096937776.1
• Coordinates: 124367..124492 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	124223..124288 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QRM68_RS00620	119600..119680	-	81	Protein_123	hypothetical protein	-
QRM68_RS00625	119750..119956	+	207	WP_000547969.1	hypothetical protein	-
QRM68_RS00630	119982..120521	+	540	WP_001593051.1	single-stranded DNA-binding protein	-
QRM68_RS00635	120579..120812	+	234	WP_000005985.1	DUF905 family protein	-
QRM68_RS00640	120871..122835	+	1965	WP_130570569.1	ParB/RepB/Spo0J family partition protein	-
QRM68_RS00645	122904..123338	+	435	WP_000845962.1	conjugation system SOS inhibitor PsiB	-
QRM68_RS00650	123335..124097	+	763	Protein_129	plasmid SOS inhibition protein A	-
-	124066..124290	+	225	NuclAT_0	-	-
-	124066..124290	+	225	NuclAT_0	-	-
-	124066..124290	+	225	NuclAT_0	-	-
-	124066..124290	+	225	NuclAT_0	-	-
-	124223..124288	-	66	-	-	Antitoxin
QRM68_RS00655	124276..124425	+	150	Protein_130	plasmid maintenance protein Mok	-
QRM68_RS00660	124367..124492	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
QRM68_RS00665	124793..125066	-	274	Protein_132	hypothetical protein	-
QRM68_RS00670	125118..125414	+	297	WP_001272245.1	hypothetical protein	-
QRM68_RS00675	125525..126346	+	822	WP_001234487.1	DUF932 domain-containing protein	-
QRM68_RS00680	126643..127233	-	591	WP_279947734.1	transglycosylase SLT domain-containing protein	-
QRM68_RS00685	127566..127949	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QRM68_RS00690	128136..128825	+	690	WP_285978676.1	conjugal transfer transcriptional regulator TraJ	-
QRM68_RS00695	128918..129319	+	402	WP_001369361.1	conjugal transfer relaxosome DNA-bindin protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	vat / vat / iroN / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucB / iucC / iucC / iucD / iutA	1..192709	192709

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T284080 WP_096937776.1 NZ_CP127301:124367-124492 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T284080 NZ_CP127301:124367-124492 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ATACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 66 bp

>AT284080 NZ_CP127301:c124288-124223 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin