Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HTH_XRE
Location 52427..53138 Replicon plasmid pAPEC201603
Accession NZ_CP127300
Organism Escherichia coli strain APEC20/16

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QRM67_RS25995 Protein ID WP_089566179.1
Coordinates 52836..53138 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QRM67_RS25990 Protein ID WP_000806445.1
Coordinates 52427..52765 (-) Length 113 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM67_RS25955 (QRM67_25960) 47963..48616 + 654 WP_077881123.1 maturation control protein -
QRM67_RS25960 (QRM67_25965) 48953..49234 + 282 WP_032323275.1 type II toxin-antitoxin system RelE/ParE family toxin -
QRM67_RS25965 (QRM67_25970) 49243..49524 + 282 WP_089566181.1 HigA family addiction module antitoxin -
QRM67_RS25970 (QRM67_25975) 49617..49946 + 330 WP_000542383.1 hypothetical protein -
QRM67_RS25975 (QRM67_25980) 49939..51132 + 1194 WP_089566180.1 phage tail protein -
QRM67_RS25980 (QRM67_25985) 51168..51947 - 780 WP_032323278.1 hypothetical protein -
QRM67_RS25985 (QRM67_25990) 52011..52370 - 360 WP_001557713.1 transcriptional regulator -
QRM67_RS25990 (QRM67_25995) 52427..52765 - 339 WP_000806445.1 HigA family addiction module antitoxin Antitoxin
QRM67_RS25995 (QRM67_26000) 52836..53138 - 303 WP_089566179.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRM67_RS26000 (QRM67_26005) 53301..54092 + 792 WP_286005039.1 phage tail protein -
QRM67_RS26005 (QRM67_26010) 54089..54409 + 321 WP_286005040.1 hypothetical protein -
QRM67_RS26010 (QRM67_26015) 54427..54855 + 429 WP_169001556.1 baseplate -
QRM67_RS26015 (QRM67_26020) 54859..55839 + 981 WP_206299259.1 tail length tape measure protein -
QRM67_RS26020 (QRM67_26025) 55884..56489 + 606 WP_223699645.1 carbohydrate-binding domain-containing protein -
QRM67_RS26025 (QRM67_26030) 56549..57454 + 906 WP_088491987.1 recombination-associated protein RdgC -
QRM67_RS26030 (QRM67_26035) 57498..58118 + 621 WP_214673039.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..93835 93835


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(6-100)

Antitoxin

Cro/C1-type helix-turn-helix domain

(16-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11804.49 Da        Isoelectric Point: 9.6743

>T284075 WP_089566179.1 NZ_CP127300:c53138-52836 [Escherichia coli]
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCNDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY

Download         Length: 303 bp

Antitoxin


Download         Length: 113 a.a.        Molecular weight: 13049.98 Da        Isoelectric Point: 6.4754

>AT284075 WP_000806445.1 NZ_CP127300:c52765-52427 [Escherichia coli]
MKQATRKPTTVGDILLYEYLEPLELKINELAEILHVHRNTVSALVNNNRKLTMDMAYRLAKAFDTSVDFWINLQTAVDLW
EVENDMRVQEELSRINTAEKFISQRNLNKKAA

Download         Length: 339 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References