Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 52427..53138 | Replicon | plasmid pAPEC201603 |
| Accession | NZ_CP127300 | ||
| Organism | Escherichia coli strain APEC20/16 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QRM67_RS25995 | Protein ID | WP_089566179.1 |
| Coordinates | 52836..53138 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QRM67_RS25990 | Protein ID | WP_000806445.1 |
| Coordinates | 52427..52765 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM67_RS25955 (QRM67_25960) | 47963..48616 | + | 654 | WP_077881123.1 | maturation control protein | - |
| QRM67_RS25960 (QRM67_25965) | 48953..49234 | + | 282 | WP_032323275.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QRM67_RS25965 (QRM67_25970) | 49243..49524 | + | 282 | WP_089566181.1 | HigA family addiction module antitoxin | - |
| QRM67_RS25970 (QRM67_25975) | 49617..49946 | + | 330 | WP_000542383.1 | hypothetical protein | - |
| QRM67_RS25975 (QRM67_25980) | 49939..51132 | + | 1194 | WP_089566180.1 | phage tail protein | - |
| QRM67_RS25980 (QRM67_25985) | 51168..51947 | - | 780 | WP_032323278.1 | hypothetical protein | - |
| QRM67_RS25985 (QRM67_25990) | 52011..52370 | - | 360 | WP_001557713.1 | transcriptional regulator | - |
| QRM67_RS25990 (QRM67_25995) | 52427..52765 | - | 339 | WP_000806445.1 | HigA family addiction module antitoxin | Antitoxin |
| QRM67_RS25995 (QRM67_26000) | 52836..53138 | - | 303 | WP_089566179.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRM67_RS26000 (QRM67_26005) | 53301..54092 | + | 792 | WP_286005039.1 | phage tail protein | - |
| QRM67_RS26005 (QRM67_26010) | 54089..54409 | + | 321 | WP_286005040.1 | hypothetical protein | - |
| QRM67_RS26010 (QRM67_26015) | 54427..54855 | + | 429 | WP_169001556.1 | baseplate | - |
| QRM67_RS26015 (QRM67_26020) | 54859..55839 | + | 981 | WP_206299259.1 | tail length tape measure protein | - |
| QRM67_RS26020 (QRM67_26025) | 55884..56489 | + | 606 | WP_223699645.1 | carbohydrate-binding domain-containing protein | - |
| QRM67_RS26025 (QRM67_26030) | 56549..57454 | + | 906 | WP_088491987.1 | recombination-associated protein RdgC | - |
| QRM67_RS26030 (QRM67_26035) | 57498..58118 | + | 621 | WP_214673039.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..93835 | 93835 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11804.49 Da Isoelectric Point: 9.6743
>T284075 WP_089566179.1 NZ_CP127300:c53138-52836 [Escherichia coli]
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCNDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHRKIPPDIHMTLSRKLDIINAATTCNDLRSPPGNRYEELSGKLNGYSSVRVNKQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|