Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 48953..49524 Replicon plasmid pAPEC201603
Accession NZ_CP127300
Organism Escherichia coli strain APEC20/16

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QRM67_RS25960 Protein ID WP_032323275.1
Coordinates 48953..49234 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QRM67_RS25965 Protein ID WP_089566181.1
Coordinates 49243..49524 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM67_RS25920 (QRM67_25925) 44280..44447 + 168 WP_169301660.1 hypothetical protein -
QRM67_RS25925 (QRM67_25930) 44622..44741 + 120 WP_071526433.1 ash family protein -
QRM67_RS25930 (QRM67_25935) 44760..44975 + 216 WP_000201263.1 host cell division inhibitor Icd-like protein -
QRM67_RS25935 (QRM67_25940) 44975..45685 + 711 Protein_61 Rha family transcriptional regulator -
QRM67_RS25940 (QRM67_25945) 45976..46260 + 285 WP_000717722.1 hypothetical protein -
QRM67_RS25945 (QRM67_25950) 46397..46756 + 360 WP_157704636.1 hypothetical protein -
QRM67_RS25950 (QRM67_25955) 46796..47617 - 822 WP_230985977.1 hypothetical protein -
QRM67_RS25955 (QRM67_25960) 47963..48616 + 654 WP_077881123.1 maturation control protein -
QRM67_RS25960 (QRM67_25965) 48953..49234 + 282 WP_032323275.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRM67_RS25965 (QRM67_25970) 49243..49524 + 282 WP_089566181.1 HigA family addiction module antitoxin Antitoxin
QRM67_RS25970 (QRM67_25975) 49617..49946 + 330 WP_000542383.1 hypothetical protein -
QRM67_RS25975 (QRM67_25980) 49939..51132 + 1194 WP_089566180.1 phage tail protein -
QRM67_RS25980 (QRM67_25985) 51168..51947 - 780 WP_032323278.1 hypothetical protein -
QRM67_RS25985 (QRM67_25990) 52011..52370 - 360 WP_001557713.1 transcriptional regulator -
QRM67_RS25990 (QRM67_25995) 52427..52765 - 339 WP_000806445.1 HigA family addiction module antitoxin -
QRM67_RS25995 (QRM67_26000) 52836..53138 - 303 WP_089566179.1 type II toxin-antitoxin system RelE/ParE family toxin -
QRM67_RS26000 (QRM67_26005) 53301..54092 + 792 WP_286005039.1 phage tail protein -
QRM67_RS26005 (QRM67_26010) 54089..54409 + 321 WP_286005040.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..93835 93835


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(1-93)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(1-86)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10606.14 Da        Isoelectric Point: 10.2589

>T284074 WP_032323275.1 NZ_CP127300:48953-49234 [Escherichia coli]
MIKSFRHKGLERFFKTGSTAGIQAKHAVKLRIQLTALNTAKRPDDMSAPGWELHPLKGADLKGHWAISVNGNWRLTFRFE
GEDAILVDYQDYH

Download         Length: 282 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10130.60 Da        Isoelectric Point: 7.3179

>AT284074 WP_089566181.1 NZ_CP127300:49243-49524 [Escherichia coli]
MSRMHNPAHPGAVLREYLGDMSVTDAAAALGITRTALSRILNEKAGISADMALRLESALGTSAEMWTGMQSQYELWVASQ
TARPNIRPLFFHA

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References