Detailed information of TA system TA284070

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 117721..118147
• Replicon: plasmid pAPEC201601
• Accession: NZ_CP127298
• Organism: Escherichia coli strain APEC20/16

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QRM67_RS24915
• Protein ID: WP_001372321.1
• Coordinates: 118022..118147 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	117721..117945 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QRM67_RS24870 (112774)	112774..113028	+	255	WP_050195272.1	hypothetical protein	-
QRM67_RS24875 (112926)	112926..113198	+	273	WP_072133095.1	hypothetical protein	-
QRM67_RS24880 (113671)	113671..114198	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
QRM67_RS24885 (114254)	114254..114487	+	234	WP_000006004.1	DUF905 domain-containing protein	-
QRM67_RS24890 (114546)	114546..116504	+	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
QRM67_RS24895 (116559)	116559..116993	+	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
QRM67_RS24900 (116990)	116990..117752	+	763	Protein_126	plasmid SOS inhibition protein A	-
QRM67_RS24905 (117721)	117721..117909	-	189	WP_001299721.1	hypothetical protein	-
- (117878)	117878..117943	+	66	NuclAT_1	-	-
- (117878)	117878..117943	-	66	NuclAT_0	-	-
- (117721)	117721..117945	+	225	NuclAT_0	-	Antitoxin
- (117721)	117721..117945	+	225	NuclAT_0	-	Antitoxin
- (117721)	117721..117945	+	225	NuclAT_0	-	Antitoxin
- (117721)	117721..117945	+	225	NuclAT_0	-	Antitoxin
- (117721)	117721..117945	-	225	NuclAT_0	-	-
QRM67_RS24910 (117931)	117931..118080	+	150	Protein_128	plasmid maintenance protein Mok	-
QRM67_RS24915 (118022)	118022..118147	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QRM67_RS24920 (118367)	118367..118597	+	231	WP_001426396.1	hypothetical protein	-
QRM67_RS24925 (118595)	118595..118768	-	174	Protein_131	hypothetical protein	-
QRM67_RS24930 (119068)	119068..119355	+	288	WP_000107535.1	hypothetical protein	-
QRM67_RS24935 (119476)	119476..120297	+	822	WP_001234469.1	DUF932 domain-containing protein	-
QRM67_RS24940 (120594)	120594..121241	-	648	WP_000614936.1	transglycosylase SLT domain-containing protein	-
QRM67_RS24945 (121518)	121518..121901	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QRM67_RS24950 (122092)	122092..122777	+	686	Protein_136	PAS domain-containing protein	-
QRM67_RS24955 (122871)	122871..123098	+	228	WP_285978930.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T284070 WP_001372321.1 NZ_CP127298:118022-118147 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT284070 NZ_CP127298:117721-117945 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin