Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 940769..941568 | Replicon | chromosome |
Accession | NZ_CP127297 | ||
Organism | Escherichia coli strain APEC20/16 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | QRM67_RS04525 | Protein ID | WP_000347267.1 |
Coordinates | 940769..941233 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QRM67_RS04530 | Protein ID | WP_001307405.1 |
Coordinates | 941233..941568 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM67_RS04495 (935770) | 935770..936204 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QRM67_RS04500 (936222) | 936222..937100 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QRM67_RS04505 (937090) | 937090..937869 | - | 780 | WP_054627033.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QRM67_RS04510 (937880) | 937880..938353 | - | 474 | WP_222699509.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QRM67_RS04515 (938376) | 938376..939656 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QRM67_RS04520 (939905) | 939905..940714 | + | 810 | WP_000072193.1 | aga operon transcriptional regulator AgaR | - |
QRM67_RS04525 (940769) | 940769..941233 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QRM67_RS04530 (941233) | 941233..941568 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QRM67_RS04535 (941717) | 941717..943289 | - | 1573 | Protein_868 | galactarate dehydratase | - |
QRM67_RS04540 (943664) | 943664..944998 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
QRM67_RS04545 (945014) | 945014..945784 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T284053 WP_000347267.1 NZ_CP127297:c941233-940769 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |