Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 143508..144110 | Replicon | chromosome |
Accession | NZ_CP127297 | ||
Organism | Escherichia coli strain APEC20/16 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QRM67_RS00645 | Protein ID | WP_205899241.1 |
Coordinates | 143799..144110 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QRM67_RS00640 | Protein ID | WP_000356397.1 |
Coordinates | 143508..143798 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM67_RS00615 (139434) | 139434..140336 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QRM67_RS00620 (140333) | 140333..140968 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QRM67_RS00625 (140965) | 140965..141894 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
QRM67_RS00630 (142224) | 142224..142466 | - | 243 | WP_001086388.1 | protein YiiF | - |
QRM67_RS00635 (142685) | 142685..142903 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
QRM67_RS00640 (143508) | 143508..143798 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QRM67_RS00645 (143799) | 143799..144110 | - | 312 | WP_205899241.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRM67_RS00650 (144339) | 144339..145247 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
QRM67_RS00655 (145311) | 145311..146252 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QRM67_RS00660 (146297) | 146297..146734 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
QRM67_RS00665 (146731) | 146731..147603 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QRM67_RS00670 (147597) | 147597..148196 | - | 600 | WP_001315111.1 | glucose-1-phosphatase | - |
QRM67_RS00675 (148295) | 148295..149080 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12189.21 Da Isoelectric Point: 10.0241
>T284051 WP_205899241.1 NZ_CP127297:c144110-143799 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDNLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDNLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|