Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 6445799..6446475 | Replicon | chromosome |
Accession | NZ_CP127296 | ||
Organism | Amycolatopsis sp. DG1A-15b |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | - |
Locus tag | QRY02_RS29555 | Protein ID | WP_285986107.1 |
Coordinates | 6446113..6446475 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QRY02_RS29550 | Protein ID | WP_285986106.1 |
Coordinates | 6445799..6446116 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRY02_RS29535 (QRY02_29535) | 6442222..6442908 | - | 687 | WP_285986103.1 | LPXTG cell wall anchor domain-containing protein | - |
QRY02_RS29540 (QRY02_29540) | 6443177..6444703 | - | 1527 | WP_285986104.1 | amino acid permease | - |
QRY02_RS29545 (QRY02_29545) | 6444796..6445713 | - | 918 | WP_285986105.1 | cation diffusion facilitator family transporter | - |
QRY02_RS29550 (QRY02_29550) | 6445799..6446116 | - | 318 | WP_285986106.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QRY02_RS29555 (QRY02_29555) | 6446113..6446475 | - | 363 | WP_285986107.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRY02_RS29560 (QRY02_29560) | 6446595..6449522 | + | 2928 | WP_285986108.1 | BTAD domain-containing putative transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13587.39 Da Isoelectric Point: 4.5268
>T284050 WP_285986107.1 NZ_CP127296:c6446475-6446113 [Amycolatopsis sp. DG1A-15b]
MAGQDWEIYVVDEVLEWIERLDDATHARVVQAIDALAEGGPGLGRPLVDTIVGSRIQNLKELRPGTVRILFVFDPWRASV
LLVAGDKAGRWNAWYGEAIPLAEDRYDRYLKERQAEEGRP
MAGQDWEIYVVDEVLEWIERLDDATHARVVQAIDALAEGGPGLGRPLVDTIVGSRIQNLKELRPGTVRILFVFDPWRASV
LLVAGDKAGRWNAWYGEAIPLAEDRYDRYLKERQAEEGRP
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|