Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 3781114..3781781 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O50411 |
Locus tag | QRF07_RS17810 | Protein ID | WP_003417916.1 |
Coordinates | 3781114..3781506 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
Locus tag | QRF07_RS17815 | Protein ID | WP_003912214.1 |
Coordinates | 3781506..3781781 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS17790 (QRF07_17790) | 3776683..3776862 | - | 180 | WP_250575601.1 | 1-deoxy-D-xylulose-5-phosphate synthase N-terminal domain-containing protein | - |
QRF07_RS17800 (QRF07_17800) | 3778319..3779308 | - | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
QRF07_RS17805 (QRF07_17805) | 3779308..3780360 | - | 1053 | WP_003900678.1 | polyprenyl synthetase family protein | - |
QRF07_RS17810 (QRF07_17810) | 3781114..3781506 | - | 393 | WP_003417916.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF07_RS17815 (QRF07_17815) | 3781506..3781781 | - | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QRF07_RS17820 (QRF07_17820) | 3781963..3783334 | + | 1372 | Protein_3520 | ISNCY family transposase | - |
QRF07_RS17825 (QRF07_17825) | 3783524..3785719 | + | 2196 | WP_010886168.1 | PE family protein | - |
QRF07_RS17830 (QRF07_17830) | 3785790..3786662 | - | 873 | WP_003906098.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | IScluster/Tn | - | - | 3776971..3783334 | 6363 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14316.74 Da Isoelectric Point: 10.7249
>T284048 WP_003417916.1 NZ_CP127277:c3781506-3781114 [Mycobacterium tuberculosis]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BXS8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E8U8S7 |