Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3532245..3532915 | Replicon | chromosome |
| Accession | NZ_CP127277 | ||
| Organism | Mycobacterium tuberculosis strain 25421 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | O53332 |
| Locus tag | QRF07_RS16740 | Protein ID | WP_003899954.1 |
| Coordinates | 3532245..3532589 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0THF6 |
| Locus tag | QRF07_RS16745 | Protein ID | WP_003899955.1 |
| Coordinates | 3532586..3532915 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF07_RS16705 (QRF07_16705) | 3527318..3528178 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
| QRF07_RS16710 (QRF07_16710) | 3528153..3528668 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
| QRF07_RS16715 (QRF07_16715) | 3528684..3528895 | + | 212 | Protein_3300 | (R)-hydratase | - |
| QRF07_RS16720 (QRF07_16720) | 3528908..3529201 | + | 294 | WP_003416635.1 | hypothetical protein | - |
| QRF07_RS16725 (QRF07_16725) | 3529489..3530778 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
| QRF07_RS16730 (QRF07_16730) | 3531125..3531559 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
| QRF07_RS16735 (QRF07_16735) | 3531562..3532014 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QRF07_RS16740 (QRF07_16740) | 3532245..3532589 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRF07_RS16745 (QRF07_16745) | 3532586..3532915 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
| QRF07_RS16750 (QRF07_16750) | 3533152..3534413 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
| QRF07_RS16755 (QRF07_16755) | 3534635..3535896 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
| QRF07_RS16760 (QRF07_16760) | 3536169..3536516 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
| QRF07_RS16765 (QRF07_16765) | 3536513..3537133 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T284045 WP_003899954.1 NZ_CP127277:3532245-3532589 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FBK2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6LTY | |
| PDB | 6LTZ | |
| AlphaFold DB | G0THF6 |