Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 2184340..2185208 | Replicon | chromosome |
| Accession | NZ_CP127277 | ||
| Organism | Mycobacterium tuberculosis strain 25421 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | QRF07_RS10200 | Protein ID | WP_010886136.1 |
| Coordinates | 2184340..2184717 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | QRF07_RS10205 | Protein ID | WP_003409886.1 |
| Coordinates | 2184759..2185208 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF07_RS10150 (QRF07_10150) | 2180129..2180581 | - | 453 | WP_003899095.1 | lipoprotein | - |
| QRF07_RS10155 (QRF07_10155) | 2180645..2181046 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| QRF07_RS10160 (QRF07_10160) | 2181039..2181221 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| QRF07_RS10165 (QRF07_10165) | 2181335..2181685 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| QRF07_RS10170 (QRF07_10170) | 2181696..2182598 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| QRF07_RS10175 (QRF07_10175) | 2182619..2182810 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| QRF07_RS10180 (QRF07_10180) | 2182811..2183107 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| QRF07_RS10185 (QRF07_10185) | 2183347..2183562 | + | 216 | WP_003409878.1 | antitoxin | - |
| QRF07_RS10190 (QRF07_10190) | 2183559..2183870 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| QRF07_RS10195 (QRF07_10195) | 2183844..2184365 | - | 522 | WP_003904745.1 | hypothetical protein | - |
| QRF07_RS10200 (QRF07_10200) | 2184340..2184717 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| QRF07_RS10205 (QRF07_10205) | 2184759..2185208 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| QRF07_RS10210 (QRF07_10210) | 2185205..2185750 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| QRF07_RS10215 (QRF07_10215) | 2185639..2186253 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| QRF07_RS10220 (QRF07_10220) | 2186302..2186598 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QRF07_RS10225 (QRF07_10225) | 2186595..2186846 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| QRF07_RS10230 (QRF07_10230) | 2186833..2187327 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| QRF07_RS10235 (QRF07_10235) | 2187487..2187894 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| QRF07_RS10240 (QRF07_10240) | 2187898..2188170 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QRF07_RS10245 (QRF07_10245) | 2188203..2189423 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T284021 WP_010886136.1 NZ_CP127277:2184340-2184717 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT284021 WP_003409886.1 NZ_CP127277:2184759-2185208 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|