Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3535083..3535753 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | QRF08_RS16790 | Protein ID | WP_003899954.1 |
Coordinates | 3535083..3535427 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | QRF08_RS16795 | Protein ID | WP_003899955.1 |
Coordinates | 3535424..3535753 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS16755 (QRF08_16755) | 3530156..3531016 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
QRF08_RS16760 (QRF08_16760) | 3530991..3531506 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
QRF08_RS16765 (QRF08_16765) | 3531522..3531733 | + | 212 | Protein_3310 | (R)-hydratase | - |
QRF08_RS16770 (QRF08_16770) | 3531746..3532039 | + | 294 | WP_003416635.1 | hypothetical protein | - |
QRF08_RS16775 (QRF08_16775) | 3532327..3533616 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
QRF08_RS16780 (QRF08_16780) | 3533963..3534397 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF08_RS16785 (QRF08_16785) | 3534400..3534852 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QRF08_RS16790 (QRF08_16790) | 3535083..3535427 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRF08_RS16795 (QRF08_16795) | 3535424..3535753 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
QRF08_RS16800 (QRF08_16800) | 3535990..3537251 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
QRF08_RS16805 (QRF08_16805) | 3537473..3538734 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
QRF08_RS16810 (QRF08_16810) | 3539007..3539354 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
QRF08_RS16815 (QRF08_16815) | 3539351..3539971 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T283984 WP_003899954.1 NZ_CP127276:3535083-3535427 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6LTY | |
PDB | 6LTZ | |
AlphaFold DB | G0THF6 |