Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2251637..2252556 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | L7N4R2 |
Locus tag | QRF08_RS10615 | Protein ID | WP_003900449.1 |
Coordinates | 2251951..2252556 (-) | Length | 202 a.a. |
Antitoxin (Protein)
Gene name | HigA2 | Uniprot ID | L7N5K9 |
Locus tag | QRF08_RS10610 | Protein ID | WP_003410124.1 |
Coordinates | 2251637..2251942 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS10580 (QRF08_10580) | 2246648..2247904 | - | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
QRF08_RS10585 (QRF08_10585) | 2248258..2248833 | + | 576 | WP_003410100.1 | hypothetical protein | - |
QRF08_RS10590 (QRF08_10590) | 2248830..2249870 | + | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
QRF08_RS10595 (QRF08_10595) | 2250112..2250831 | + | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
QRF08_RS10600 (QRF08_10600) | 2250821..2251237 | + | 417 | WP_003410114.1 | hypothetical protein | - |
QRF08_RS10605 (QRF08_10605) | 2251253..2251552 | - | 300 | WP_003410120.1 | hypothetical protein | - |
QRF08_RS10610 (QRF08_10610) | 2251637..2251942 | - | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
QRF08_RS10615 (QRF08_10615) | 2251951..2252556 | - | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRF08_RS10620 (QRF08_10620) | 2252581..2252940 | - | 360 | WP_003410131.1 | hypothetical protein | - |
QRF08_RS10625 (QRF08_10625) | 2253100..2253495 | - | 396 | WP_225936727.1 | hypothetical protein | - |
QRF08_RS10630 (QRF08_10630) | 2253555..2255072 | - | 1518 | Protein_2101 | DEAD/DEAH box helicase family protein | - |
QRF08_RS10635 (QRF08_10635) | 2255582..2256580 | - | 999 | WP_003410146.1 | cation diffusion facilitator family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T283966 WP_003900449.1 NZ_CP127276:c2252556-2251951 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV20 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7EWC | |
PDB | 7EWD | |
PDB | 7EWE | |
AlphaFold DB | A0A7U4BV30 |