Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3525771..3526441 | Replicon | chromosome |
Accession | NZ_CP127275 | ||
Organism | Mycobacterium tuberculosis strain 6721 |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | QRF09_RS16730 | Protein ID | WP_003899954.1 |
Coordinates | 3525771..3526115 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | QRF09_RS16735 | Protein ID | WP_003899955.1 |
Coordinates | 3526112..3526441 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF09_RS16695 (QRF09_16695) | 3520844..3521704 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
QRF09_RS16700 (QRF09_16700) | 3521679..3522194 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
QRF09_RS16705 (QRF09_16705) | 3522210..3522421 | + | 212 | Protein_3298 | (R)-hydratase | - |
QRF09_RS16710 (QRF09_16710) | 3522434..3522727 | + | 294 | WP_003416635.1 | hypothetical protein | - |
QRF09_RS16715 (QRF09_16715) | 3523015..3524304 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
QRF09_RS16720 (QRF09_16720) | 3524651..3525085 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF09_RS16725 (QRF09_16725) | 3525088..3525540 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QRF09_RS16730 (QRF09_16730) | 3525771..3526115 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRF09_RS16735 (QRF09_16735) | 3526112..3526441 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
QRF09_RS16740 (QRF09_16740) | 3526678..3527939 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
QRF09_RS16745 (QRF09_16745) | 3528161..3529422 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
QRF09_RS16750 (QRF09_16750) | 3529695..3530042 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
QRF09_RS16755 (QRF09_16755) | 3530039..3530659 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T283923 WP_003899954.1 NZ_CP127275:3525771-3526115 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6LTY | |
PDB | 6LTZ | |
AlphaFold DB | G0THF6 |