Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 2182081..2182949 | Replicon | chromosome |
| Accession | NZ_CP127275 | ||
| Organism | Mycobacterium tuberculosis strain 6721 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | QRF09_RS10200 | Protein ID | WP_010886136.1 |
| Coordinates | 2182081..2182458 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | QRF09_RS10205 | Protein ID | WP_003409886.1 |
| Coordinates | 2182500..2182949 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF09_RS10150 (QRF09_10150) | 2177870..2178322 | - | 453 | WP_003899095.1 | lipoprotein | - |
| QRF09_RS10155 (QRF09_10155) | 2178386..2178787 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| QRF09_RS10160 (QRF09_10160) | 2178780..2178962 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| QRF09_RS10165 (QRF09_10165) | 2179076..2179426 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| QRF09_RS10170 (QRF09_10170) | 2179437..2180339 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| QRF09_RS10175 (QRF09_10175) | 2180360..2180551 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| QRF09_RS10180 (QRF09_10180) | 2180552..2180848 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| QRF09_RS10185 (QRF09_10185) | 2181088..2181303 | + | 216 | WP_003409878.1 | antitoxin | - |
| QRF09_RS10190 (QRF09_10190) | 2181300..2181611 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| QRF09_RS10195 (QRF09_10195) | 2181585..2182106 | - | 522 | WP_003904745.1 | hypothetical protein | - |
| QRF09_RS10200 (QRF09_10200) | 2182081..2182458 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| QRF09_RS10205 (QRF09_10205) | 2182500..2182949 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| QRF09_RS10210 (QRF09_10210) | 2182946..2183491 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| QRF09_RS10215 (QRF09_10215) | 2183380..2183994 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| QRF09_RS10220 (QRF09_10220) | 2184043..2184339 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QRF09_RS10225 (QRF09_10225) | 2184336..2184587 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| QRF09_RS10230 (QRF09_10230) | 2184574..2185068 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| QRF09_RS10235 (QRF09_10235) | 2185228..2185635 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| QRF09_RS10240 (QRF09_10240) | 2185639..2185911 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QRF09_RS10245 (QRF09_10245) | 2185944..2187164 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T283899 WP_010886136.1 NZ_CP127275:2182081-2182458 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT283899 WP_003409886.1 NZ_CP127275:2182500-2182949 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|