Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3534259..3534929 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | QRF10_RS16770 | Protein ID | WP_003899954.1 |
Coordinates | 3534259..3534603 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | QRF10_RS16775 | Protein ID | WP_003899955.1 |
Coordinates | 3534600..3534929 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS16735 (QRF10_16735) | 3529332..3530192 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
QRF10_RS16740 (QRF10_16740) | 3530167..3530682 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
QRF10_RS16745 (QRF10_16745) | 3530698..3530909 | + | 212 | Protein_3306 | (R)-hydratase | - |
QRF10_RS16750 (QRF10_16750) | 3530922..3531215 | + | 294 | WP_003416635.1 | hypothetical protein | - |
QRF10_RS16755 (QRF10_16755) | 3531503..3532792 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
QRF10_RS16760 (QRF10_16760) | 3533139..3533573 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF10_RS16765 (QRF10_16765) | 3533576..3534028 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QRF10_RS16770 (QRF10_16770) | 3534259..3534603 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRF10_RS16775 (QRF10_16775) | 3534600..3534929 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
QRF10_RS16780 (QRF10_16780) | 3535166..3536427 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
QRF10_RS16785 (QRF10_16785) | 3536649..3537910 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
QRF10_RS16790 (QRF10_16790) | 3538183..3538530 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
QRF10_RS16795 (QRF10_16795) | 3538527..3539147 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T283862 WP_003899954.1 NZ_CP127274:3534259-3534603 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6LTY | |
PDB | 6LTZ | |
AlphaFold DB | G0THF6 |