Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2250739..2251658 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | L7N4R2 |
Locus tag | QRF10_RS10600 | Protein ID | WP_003900449.1 |
Coordinates | 2251053..2251658 (-) | Length | 202 a.a. |
Antitoxin (Protein)
Gene name | HigA2 | Uniprot ID | L7N5K9 |
Locus tag | QRF10_RS10595 | Protein ID | WP_003410124.1 |
Coordinates | 2250739..2251044 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS10565 (QRF10_10565) | 2245750..2247006 | - | 1257 | WP_003410095.1 | HNH endonuclease signature motif containing protein | - |
QRF10_RS10570 (QRF10_10570) | 2247360..2247935 | + | 576 | WP_003410100.1 | hypothetical protein | - |
QRF10_RS10575 (QRF10_10575) | 2247932..2248972 | + | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
QRF10_RS10580 (QRF10_10580) | 2249214..2249933 | + | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
QRF10_RS10585 (QRF10_10585) | 2249923..2250339 | + | 417 | WP_003410114.1 | hypothetical protein | - |
QRF10_RS10590 (QRF10_10590) | 2250355..2250654 | - | 300 | WP_003410120.1 | hypothetical protein | - |
QRF10_RS10595 (QRF10_10595) | 2250739..2251044 | - | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
QRF10_RS10600 (QRF10_10600) | 2251053..2251658 | - | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRF10_RS10605 (QRF10_10605) | 2251683..2252042 | - | 360 | WP_003410131.1 | hypothetical protein | - |
QRF10_RS10610 (QRF10_10610) | 2252202..2252597 | - | 396 | WP_079156352.1 | hypothetical protein | - |
QRF10_RS10615 (QRF10_10615) | 2252657..2254174 | - | 1518 | Protein_2098 | DEAD/DEAH box helicase family protein | - |
QRF10_RS10620 (QRF10_10620) | 2254684..2255682 | - | 999 | WP_003410146.1 | cation diffusion facilitator family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T283844 WP_003900449.1 NZ_CP127274:c2251658-2251053 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV20 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7EWC | |
PDB | 7EWD | |
PDB | 7EWE | |
AlphaFold DB | A0A7U4BV30 |