Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
Location | 2185653..2186521 | Replicon | chromosome |
Accession | NZ_CP127274 | ||
Organism | Mycobacterium tuberculosis strain 17221 |
Toxin (Protein)
Gene name | higB | Uniprot ID | P9WJA4 |
Locus tag | QRF10_RS10225 | Protein ID | WP_010886136.1 |
Coordinates | 2185653..2186030 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QRF10_RS10230 | Protein ID | WP_003913306.1 |
Coordinates | 2186072..2186521 (+) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF10_RS10175 (QRF10_10175) | 2181442..2181894 | - | 453 | WP_003899095.1 | lipoprotein | - |
QRF10_RS10180 (QRF10_10180) | 2181958..2182359 | + | 402 | WP_003409869.1 | hypothetical protein | - |
QRF10_RS10185 (QRF10_10185) | 2182352..2182534 | - | 183 | WP_003409870.1 | hypothetical protein | - |
QRF10_RS10190 (QRF10_10190) | 2182648..2182998 | - | 351 | WP_003899096.1 | hypothetical protein | - |
QRF10_RS10195 (QRF10_10195) | 2183009..2183911 | - | 903 | WP_003899097.1 | hypothetical protein | - |
QRF10_RS10200 (QRF10_10200) | 2183932..2184123 | - | 192 | WP_003409876.1 | hypothetical protein | - |
QRF10_RS10205 (QRF10_10205) | 2184124..2184420 | - | 297 | WP_003409877.1 | hypothetical protein | - |
QRF10_RS10210 (QRF10_10210) | 2184660..2184875 | + | 216 | WP_003409878.1 | antitoxin | - |
QRF10_RS10215 (QRF10_10215) | 2184872..2185183 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF10_RS10220 (QRF10_10220) | 2185157..2185678 | - | 522 | WP_003904745.1 | hypothetical protein | - |
QRF10_RS10225 (QRF10_10225) | 2185653..2186030 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
QRF10_RS10230 (QRF10_10230) | 2186072..2186521 | + | 450 | WP_003913306.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
QRF10_RS10235 (QRF10_10235) | 2186518..2187063 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
QRF10_RS10240 (QRF10_10240) | 2186952..2187566 | - | 615 | WP_003901296.1 | hypothetical protein | - |
QRF10_RS10245 (QRF10_10245) | 2187615..2187911 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QRF10_RS10250 (QRF10_10250) | 2187908..2188159 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
QRF10_RS10255 (QRF10_10255) | 2188146..2188640 | + | 495 | WP_003899099.1 | hypothetical protein | - |
QRF10_RS10260 (QRF10_10260) | 2188800..2189207 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF10_RS10265 (QRF10_10265) | 2189211..2189483 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QRF10_RS10270 (QRF10_10270) | 2189516..2190736 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T283838 WP_010886136.1 NZ_CP127274:2185653-2186030 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16776.16 Da Isoelectric Point: 8.0771
>AT283838 WP_003913306.1 NZ_CP127274:2186072-2186521 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVS
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVS
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|