Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2249787..2250706 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | L7N4R2 |
| Locus tag | QQ046_RS10575 | Protein ID | WP_003900449.1 |
| Coordinates | 2250101..2250706 (-) | Length | 202 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | L7N5K9 |
| Locus tag | QQ046_RS10570 | Protein ID | WP_003410124.1 |
| Coordinates | 2249787..2250092 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS10540 (QQ046_10540) | 2244798..2246054 | - | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
| QQ046_RS10545 (QQ046_10545) | 2246408..2246983 | + | 576 | WP_003410100.1 | hypothetical protein | - |
| QQ046_RS10550 (QQ046_10550) | 2246980..2248020 | + | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QQ046_RS10555 (QQ046_10555) | 2248262..2248981 | + | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
| QQ046_RS10560 (QQ046_10560) | 2248971..2249387 | + | 417 | WP_003410114.1 | hypothetical protein | - |
| QQ046_RS10565 (QQ046_10565) | 2249403..2249702 | - | 300 | WP_003410120.1 | hypothetical protein | - |
| QQ046_RS10570 (QQ046_10570) | 2249787..2250092 | - | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
| QQ046_RS10575 (QQ046_10575) | 2250101..2250706 | - | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQ046_RS10580 (QQ046_10580) | 2250731..2251090 | - | 360 | WP_003410131.1 | hypothetical protein | - |
| QQ046_RS10585 (QQ046_10585) | 2251250..2251645 | - | 396 | WP_225936727.1 | hypothetical protein | - |
| QQ046_RS10590 (QQ046_10590) | 2251705..2253222 | - | 1518 | Protein_2093 | DEAD/DEAH box helicase family protein | - |
| QQ046_RS10595 (QQ046_10595) | 2253732..2254730 | - | 999 | WP_003410146.1 | cation diffusion facilitator family transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T283784 WP_003900449.1 NZ_CP127273:c2250706-2250101 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BV20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7EWC | |
| PDB | 7EWD | |
| PDB | 7EWE | |
| AlphaFold DB | A0A7U4BV30 |