Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 2184701..2185569 | Replicon | chromosome |
| Accession | NZ_CP127273 | ||
| Organism | Mycobacterium tuberculosis strain 3320 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | QQ046_RS10200 | Protein ID | WP_010886136.1 |
| Coordinates | 2184701..2185078 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | QQ046_RS10205 | Protein ID | WP_003409886.1 |
| Coordinates | 2185120..2185569 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ046_RS10150 (QQ046_10150) | 2180490..2180942 | - | 453 | WP_003899095.1 | lipoprotein | - |
| QQ046_RS10155 (QQ046_10155) | 2181006..2181407 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| QQ046_RS10160 (QQ046_10160) | 2181400..2181582 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| QQ046_RS10165 (QQ046_10165) | 2181696..2182046 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| QQ046_RS10170 (QQ046_10170) | 2182057..2182959 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| QQ046_RS10175 (QQ046_10175) | 2182980..2183171 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| QQ046_RS10180 (QQ046_10180) | 2183172..2183468 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| QQ046_RS10185 (QQ046_10185) | 2183708..2183923 | + | 216 | WP_003409878.1 | antitoxin | - |
| QQ046_RS10190 (QQ046_10190) | 2183920..2184231 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| QQ046_RS10195 (QQ046_10195) | 2184205..2184726 | - | 522 | WP_003904745.1 | hypothetical protein | - |
| QQ046_RS10200 (QQ046_10200) | 2184701..2185078 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| QQ046_RS10205 (QQ046_10205) | 2185120..2185569 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| QQ046_RS10210 (QQ046_10210) | 2185566..2186111 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| QQ046_RS10215 (QQ046_10215) | 2186000..2186614 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| QQ046_RS10220 (QQ046_10220) | 2186663..2186959 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QQ046_RS10225 (QQ046_10225) | 2186956..2187207 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| QQ046_RS10230 (QQ046_10230) | 2187194..2187688 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| QQ046_RS10235 (QQ046_10235) | 2187848..2188255 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| QQ046_RS10240 (QQ046_10240) | 2188259..2188531 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QQ046_RS10245 (QQ046_10245) | 2188564..2189784 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T283778 WP_010886136.1 NZ_CP127273:2184701-2185078 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT283778 WP_003409886.1 NZ_CP127273:2185120-2185569 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|