Detailed information of TA system TA283740

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 73841..74258
• Replicon: plasmid pQ501
• Accession: NZ_CP127256
• Organism: Escherichia coli strain Q5

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QQ972_RS24450
• Protein ID: WP_096937776.1
• Coordinates: 74133..74258 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	73841..74035 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QQ972_RS24410 (68962)	68962..69463	-	502	Protein_76	hypothetical protein	-
QQ972_RS24415 (69533)	69533..69739	+	207	WP_000275848.1	hypothetical protein	-
QQ972_RS24420 (69765)	69765..70292	+	528	WP_000290825.1	single-stranded DNA-binding protein	-
QQ972_RS24425 (70350)	70350..70593	+	244	Protein_79	DUF905 family protein	-
QQ972_RS24430 (70659)	70659..72624	+	1966	Protein_80	ParB/RepB/Spo0J family partition protein	-
QQ972_RS24435 (72679)	72679..73113	+	435	WP_001297861.1	conjugation system SOS inhibitor PsiB	-
QQ972_RS24440 (73110)	73110..73851	+	742	Protein_82	plasmid SOS inhibition protein A	-
- (73841)	73841..74035	+	195	NuclAT_0	-	Antitoxin
- (73841)	73841..74035	+	195	NuclAT_0	-	Antitoxin
- (73841)	73841..74035	+	195	NuclAT_0	-	Antitoxin
- (73841)	73841..74035	+	195	NuclAT_0	-	Antitoxin
QQ972_RS24445 (74042)	74042..74191	+	150	Protein_83	DUF5431 family protein	-
QQ972_RS24450 (74133)	74133..74258	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
QQ972_RS24455 (74499)	74499..74747	-	249	Protein_85	hypothetical protein	-
QQ972_RS24460 (74804)	74804..75090	+	287	Protein_86	hypothetical protein	-
QQ972_RS24465 (75208)	75208..76028	+	821	Protein_87	DUF932 domain-containing protein	-
QQ972_RS24470 (76324)	76324..76834	-	511	Protein_88	transglycosylase SLT domain-containing protein	-
QQ972_RS24475 (77257)	77257..77640	+	384	WP_285985001.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QQ972_RS24480 (77833)	77833..78525	+	693	WP_285985002.1	PAS domain-containing protein	-
QQ972_RS24485 (78613)	78613..78840	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
QQ972_RS24490 (78874)	78874..79233	+	360	WP_000340272.1	type IV conjugative transfer system pilin TraA	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	iroN / iroN / iroE / iroD / iroC / iroB / papH / papC / papD / vat / vat / afaC-I	1..137541	137541

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T283740 WP_096937776.1 NZ_CP127256:74133-74258 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 195 bp

>AT283740 NZ_CP127256:73841-74035 [Escherichia coli]
TCACACGGATTACCCGTAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGCGAGTGTGGTCAGCGTGCAGGTATATGGGCT
ATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGACAAA
AGCCCCGTAGTTAATTTTTCATTAATCCACGAGGC

Structures

Antitoxin