Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4640948..4641194 | Replicon | chromosome |
| Accession | NZ_CP127255 | ||
| Organism | Escherichia coli strain Q5 | ||
Toxin (Protein)
| Gene name | hokX | Uniprot ID | S1PD89 |
| Locus tag | QQ972_RS22565 | Protein ID | WP_000956458.1 |
| Coordinates | 4640948..4641100 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokX | ||
| Locus tag | - | ||
| Coordinates | 4641140..4641194 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ972_RS22550 | 4636775..4637683 | - | 909 | WP_000372392.1 | sulfate adenylyltransferase subunit CysD | - |
| QQ972_RS22555 | 4637935..4638972 | + | 1038 | WP_097738253.1 | alkaline phosphatase isozyme conversion aminopeptidase | - |
| QQ972_RS22560 | 4639089..4640753 | - | 1665 | Protein_4404 | CRISPR-associated helicase Cas3' | - |
| QQ972_RS22565 | 4640948..4641100 | - | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
| - | 4641140..4641194 | + | 55 | - | - | Antitoxin |
| QQ972_RS22570 | 4641365..4642099 | - | 735 | WP_000039862.1 | phosphoadenosine phosphosulfate reductase | - |
| QQ972_RS22575 | 4642173..4643885 | - | 1713 | WP_001290708.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
| QQ972_RS22580 | 4643885..4645684 | - | 1800 | WP_000211914.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T283735 WP_000956458.1 NZ_CP127255:c4641100-4640948 [Escherichia coli]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 55 bp
>AT283735 NZ_CP127255:4641140-4641194 [Escherichia coli]
GTTTGGGTTCGAACGTAAGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
GTTTGGGTTCGAACGTAAGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|