Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 3026604..3026825 Replicon chromosome
Accession NZ_CP127255
Organism Escherichia coli strain Q5

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag QQ972_RS14720 Protein ID WP_000170963.1
Coordinates 3026604..3026711 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 3026759..3026825 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ972_RS14695 (3022448) 3022448..3023530 + 1083 WP_000804726.1 peptide chain release factor 1 -
QQ972_RS14700 (3023530) 3023530..3024363 + 834 WP_000456476.1 peptide chain release factor N(5)-glutamine methyltransferase -
QQ972_RS14705 (3024360) 3024360..3024752 + 393 WP_000200375.1 invasion regulator SirB2 -
QQ972_RS14710 (3024756) 3024756..3025565 + 810 WP_001257054.1 invasion regulator SirB1 -
QQ972_RS14715 (3025601) 3025601..3026455 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QQ972_RS14720 (3026604) 3026604..3026711 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (3026761) 3026761..3026824 + 64 NuclAT_13 - -
- (3026761) 3026761..3026824 + 64 NuclAT_13 - -
- (3026761) 3026761..3026824 + 64 NuclAT_13 - -
- (3026761) 3026761..3026824 + 64 NuclAT_13 - -
- (3026761) 3026761..3026824 + 64 NuclAT_15 - -
- (3026761) 3026761..3026824 + 64 NuclAT_15 - -
- (3026761) 3026761..3026824 + 64 NuclAT_15 - -
- (3026761) 3026761..3026824 + 64 NuclAT_15 - -
- (3026761) 3026761..3026824 + 64 NuclAT_17 - -
- (3026761) 3026761..3026824 + 64 NuclAT_17 - -
- (3026761) 3026761..3026824 + 64 NuclAT_17 - -
- (3026761) 3026761..3026824 + 64 NuclAT_17 - -
- (3026761) 3026761..3026824 + 64 NuclAT_19 - -
- (3026761) 3026761..3026824 + 64 NuclAT_19 - -
- (3026761) 3026761..3026824 + 64 NuclAT_19 - -
- (3026761) 3026761..3026824 + 64 NuclAT_19 - -
- (3026761) 3026761..3026824 + 64 NuclAT_20 - -
- (3026761) 3026761..3026824 + 64 NuclAT_20 - -
- (3026761) 3026761..3026824 + 64 NuclAT_20 - -
- (3026761) 3026761..3026824 + 64 NuclAT_20 - -
- (3026761) 3026761..3026824 + 64 NuclAT_22 - -
- (3026761) 3026761..3026824 + 64 NuclAT_22 - -
- (3026761) 3026761..3026824 + 64 NuclAT_22 - -
- (3026761) 3026761..3026824 + 64 NuclAT_22 - -
- (3026759) 3026759..3026825 + 67 NuclAT_4 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_4 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_4 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_4 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_5 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_5 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_5 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_5 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_6 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_6 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_6 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_6 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_7 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_7 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_7 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_7 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_8 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_8 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_8 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_8 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_9 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_9 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_9 - Antitoxin
- (3026759) 3026759..3026825 + 67 NuclAT_9 - Antitoxin
QQ972_RS14725 (3027116) 3027116..3028216 - 1101 WP_097752081.1 sodium-potassium/proton antiporter ChaA -
QQ972_RS14730 (3028486) 3028486..3028716 + 231 WP_001146444.1 putative cation transport regulator ChaB -
QQ972_RS14735 (3028874) 3028874..3029569 + 696 WP_285984827.1 glutathione-specific gamma-glutamylcyclotransferase -
QQ972_RS14740 (3029613) 3029613..3029966 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QQ972_RS14745 (3030151) 3030151..3031545 + 1395 WP_097752083.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T283725 WP_000170963.1 NZ_CP127255:c3026711-3026604 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT283725 NZ_CP127255:3026759-3026825 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGGTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References