Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-timR/Ldr(toxin) |
| Location | 3026604..3026825 | Replicon | chromosome |
| Accession | NZ_CP127255 | ||
| Organism | Escherichia coli strain Q5 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | QQ972_RS14720 | Protein ID | WP_000170963.1 |
| Coordinates | 3026604..3026711 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | timR | ||
| Locus tag | - | ||
| Coordinates | 3026759..3026825 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ972_RS14695 (3022448) | 3022448..3023530 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| QQ972_RS14700 (3023530) | 3023530..3024363 | + | 834 | WP_000456476.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| QQ972_RS14705 (3024360) | 3024360..3024752 | + | 393 | WP_000200375.1 | invasion regulator SirB2 | - |
| QQ972_RS14710 (3024756) | 3024756..3025565 | + | 810 | WP_001257054.1 | invasion regulator SirB1 | - |
| QQ972_RS14715 (3025601) | 3025601..3026455 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| QQ972_RS14720 (3026604) | 3026604..3026711 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_13 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_13 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_13 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_13 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_15 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_15 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_15 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_15 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_17 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_17 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_17 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_17 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_19 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_19 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_19 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_19 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_20 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_20 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_20 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_20 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_22 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_22 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_22 | - | - |
| - (3026761) | 3026761..3026824 | + | 64 | NuclAT_22 | - | - |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_4 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_4 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_4 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_4 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_5 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_5 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_5 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_5 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_6 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_6 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_6 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_6 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_7 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_7 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_7 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_7 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_8 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_8 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_8 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_8 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_9 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_9 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_9 | - | Antitoxin |
| - (3026759) | 3026759..3026825 | + | 67 | NuclAT_9 | - | Antitoxin |
| QQ972_RS14725 (3027116) | 3027116..3028216 | - | 1101 | WP_097752081.1 | sodium-potassium/proton antiporter ChaA | - |
| QQ972_RS14730 (3028486) | 3028486..3028716 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| QQ972_RS14735 (3028874) | 3028874..3029569 | + | 696 | WP_285984827.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| QQ972_RS14740 (3029613) | 3029613..3029966 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
| QQ972_RS14745 (3030151) | 3030151..3031545 | + | 1395 | WP_097752083.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T283725 WP_000170963.1 NZ_CP127255:c3026711-3026604 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT283725 NZ_CP127255:3026759-3026825 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGGTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGGTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|