Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 2251234..2251913 | Replicon | chromosome |
Accession | NZ_CP127255 | ||
Organism | Escherichia coli strain Q5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QQ972_RS10700 | Protein ID | WP_000057523.1 |
Coordinates | 2251234..2251536 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QQ972_RS10705 | Protein ID | WP_000806442.1 |
Coordinates | 2251572..2251913 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ972_RS10680 (2246498) | 2246498..2247718 | - | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
QQ972_RS10685 (2247936) | 2247936..2249588 | + | 1653 | WP_016233905.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
QQ972_RS10690 (2249625) | 2249625..2250104 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QQ972_RS10695 (2250307) | 2250307..2251101 | - | 795 | WP_089695977.1 | TraB/GumN family protein | - |
QQ972_RS10700 (2251234) | 2251234..2251536 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQ972_RS10705 (2251572) | 2251572..2251913 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QQ972_RS10710 (2251971) | 2251971..2254475 | - | 2505 | WP_000083982.1 | copper-exporting P-type ATPase CopA | - |
QQ972_RS10715 (2254737) | 2254737..2255669 | + | 933 | WP_285984985.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T283724 WP_000057523.1 NZ_CP127255:2251234-2251536 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|