Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1697949..1698207 | Replicon | chromosome |
Accession | NZ_CP127255 | ||
Organism | Escherichia coli strain Q5 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | QQ972_RS08155 | Protein ID | WP_000809168.1 |
Coordinates | 1697949..1698101 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 1698150..1698207 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ972_RS08135 | 1693193..1693906 | - | 714 | WP_001102393.1 | acidic protein MsyB | - |
QQ972_RS08140 | 1693932..1694336 | - | 405 | WP_097752027.1 | DUF2541 family protein | - |
QQ972_RS08145 | 1694709..1696625 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
QQ972_RS08150 | 1696714..1697844 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
QQ972_RS08155 | 1697949..1698101 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 1698150..1698207 | + | 58 | - | - | Antitoxin |
QQ972_RS08160 | 1698716..1699477 | + | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
QQ972_RS08165 | 1699498..1700991 | + | 1494 | WP_285984965.1 | sulfatase-like hydrolase/transferase | - |
QQ972_RS08170 | 1701120..1702379 | + | 1260 | WP_285984966.1 | cytoplasmic protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T283720 WP_000809168.1 NZ_CP127255:c1698101-1697949 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT283720 NZ_CP127255:1698150-1698207 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|