Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 216863..217662 | Replicon | chromosome |
| Accession | NZ_CP127255 | ||
| Organism | Escherichia coli strain Q5 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | QQ972_RS01045 | Protein ID | WP_001592740.1 |
| Coordinates | 217198..217662 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | QQ972_RS01040 | Protein ID | WP_001296435.1 |
| Coordinates | 216863..217198 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ972_RS01025 (212648) | 212648..213418 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| QQ972_RS01030 (213434) | 213434..214768 | - | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QQ972_RS01035 (215143) | 215143..216714 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
| QQ972_RS01040 (216863) | 216863..217198 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QQ972_RS01045 (217198) | 217198..217662 | + | 465 | WP_001592740.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QQ972_RS01050 (217717) | 217717..218526 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QQ972_RS01055 (218775) | 218775..220055 | + | 1281 | WP_000681941.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QQ972_RS01060 (220078) | 220078..220551 | + | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QQ972_RS01065 (220562) | 220562..221341 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QQ972_RS01070 (221331) | 221331..222209 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QQ972_RS01075 (222227) | 222227..222661 | + | 435 | WP_000948834.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17776.15 Da Isoelectric Point: 9.6927
>T283718 WP_001592740.1 NZ_CP127255:217198-217662 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KNWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KNWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|