Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4886735..4887534 | Replicon | chromosome |
Accession | NZ_CP127252 | ||
Organism | Escherichia coli strain C41 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | QQ971_RS23860 | Protein ID | WP_000347266.1 |
Coordinates | 4887070..4887534 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QQ971_RS23855 | Protein ID | WP_001307405.1 |
Coordinates | 4886735..4887070 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ971_RS23840 (4882520) | 4882520..4883290 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
QQ971_RS23845 (4883306) | 4883306..4884640 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
QQ971_RS23850 (4885015) | 4885015..4886586 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
QQ971_RS23855 (4886735) | 4886735..4887070 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QQ971_RS23860 (4887070) | 4887070..4887534 | + | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QQ971_RS23865 (4887589) | 4887589..4888398 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QQ971_RS23870 (4888647) | 4888647..4889927 | + | 1281 | WP_097313944.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QQ971_RS23875 (4889950) | 4889950..4890423 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QQ971_RS23880 (4890434) | 4890434..4891213 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QQ971_RS23885 (4891203) | 4891203..4892081 | + | 879 | WP_115195113.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QQ971_RS23890 (4892099) | 4892099..4892533 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4876080..4887534 | 11454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T283710 WP_000347266.1 NZ_CP127252:4887070-4887534 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |