Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-orzP/Ldr(toxin) |
Location | 2665667..2665889 | Replicon | chromosome |
Accession | NZ_CP127252 | ||
Organism | Escherichia coli strain C41 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | B7LGX8 |
Locus tag | QQ971_RS12945 | Protein ID | WP_000170965.1 |
Coordinates | 2665667..2665774 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | orzP | ||
Locus tag | - | ||
Coordinates | 2665822..2665889 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQ971_RS12915 (2661522) | 2661522..2662355 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
QQ971_RS12920 (2662352) | 2662352..2662744 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
QQ971_RS12925 (2662748) | 2662748..2663557 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
QQ971_RS12930 (2663593) | 2663593..2664447 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
QQ971_RS12935 (2664596) | 2664596..2664703 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2664753) | 2664753..2664816 | + | 64 | NuclAT_39 | - | - |
- (2664753) | 2664753..2664816 | + | 64 | NuclAT_39 | - | - |
- (2664753) | 2664753..2664816 | + | 64 | NuclAT_39 | - | - |
- (2664753) | 2664753..2664816 | + | 64 | NuclAT_39 | - | - |
- (2664753) | 2664753..2664816 | + | 64 | NuclAT_41 | - | - |
- (2664753) | 2664753..2664816 | + | 64 | NuclAT_41 | - | - |
- (2664753) | 2664753..2664816 | + | 64 | NuclAT_41 | - | - |
- (2664753) | 2664753..2664816 | + | 64 | NuclAT_41 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_26 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_26 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_26 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_26 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_28 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_28 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_28 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_28 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_30 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_30 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_30 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_30 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_32 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_32 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_32 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_32 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_34 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_34 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_34 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_34 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_36 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_36 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_36 | - | - |
- (2664751) | 2664751..2664817 | + | 67 | NuclAT_36 | - | - |
QQ971_RS12940 (2665131) | 2665131..2665238 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2665291) | 2665291..2665352 | + | 62 | NuclAT_38 | - | - |
- (2665291) | 2665291..2665352 | + | 62 | NuclAT_38 | - | - |
- (2665291) | 2665291..2665352 | + | 62 | NuclAT_38 | - | - |
- (2665291) | 2665291..2665352 | + | 62 | NuclAT_38 | - | - |
- (2665291) | 2665291..2665352 | + | 62 | NuclAT_40 | - | - |
- (2665291) | 2665291..2665352 | + | 62 | NuclAT_40 | - | - |
- (2665291) | 2665291..2665352 | + | 62 | NuclAT_40 | - | - |
- (2665291) | 2665291..2665352 | + | 62 | NuclAT_40 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_27 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_27 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_27 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_27 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_29 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_29 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_29 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_29 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_31 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_31 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_31 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_31 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_33 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_33 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_33 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_33 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_35 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_35 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_35 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_35 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_37 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_37 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_37 | - | - |
- (2665291) | 2665291..2665353 | + | 63 | NuclAT_37 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_15 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_15 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_15 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_15 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_17 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_17 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_17 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_17 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_19 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_19 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_19 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_19 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_21 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_21 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_21 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_21 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_23 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_23 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_23 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_23 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_25 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_25 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_25 | - | - |
- (2665291) | 2665291..2665354 | + | 64 | NuclAT_25 | - | - |
QQ971_RS12945 (2665667) | 2665667..2665774 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_14 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_14 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_14 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_14 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_16 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_16 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_16 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_16 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_18 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_18 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_18 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_18 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_20 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_20 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_20 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_20 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_22 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_22 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_22 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_22 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_24 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_24 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_24 | - | Antitoxin |
- (2665822) | 2665822..2665889 | + | 68 | NuclAT_24 | - | Antitoxin |
QQ971_RS12950 (2666179) | 2666179..2667279 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
QQ971_RS12955 (2667549) | 2667549..2667779 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
QQ971_RS12960 (2667937) | 2667937..2668632 | + | 696 | WP_001355927.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
QQ971_RS12965 (2668676) | 2668676..2669029 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
QQ971_RS12970 (2669214) | 2669214..2670608 | + | 1395 | WP_000086213.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T283694 WP_000170965.1 NZ_CP127252:c2665774-2665667 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT283694 NZ_CP127252:2665822-2665889 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|