Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 649362..649964 | Replicon | chromosome |
| Accession | NZ_CP127252 | ||
| Organism | Escherichia coli strain C41 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QQ971_RS03145 | Protein ID | WP_000897305.1 |
| Coordinates | 649362..649673 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QQ971_RS03150 | Protein ID | WP_089625183.1 |
| Coordinates | 649674..649964 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ971_RS03120 (645276) | 645276..645875 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| QQ971_RS03125 (645869) | 645869..646741 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QQ971_RS03130 (646738) | 646738..647175 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QQ971_RS03135 (647220) | 647220..648161 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QQ971_RS03140 (648225) | 648225..649133 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| QQ971_RS03145 (649362) | 649362..649673 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QQ971_RS03150 (649674) | 649674..649964 | + | 291 | WP_089625183.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QQ971_RS03155 (650550) | 650550..650768 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| QQ971_RS03160 (650986) | 650986..651228 | + | 243 | WP_001086388.1 | protein YiiF | - |
| QQ971_RS03165 (651457) | 651457..652437 | - | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
| QQ971_RS03170 (652837) | 652837..653766 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| QQ971_RS03175 (653763) | 653763..654398 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 651457..652437 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T283687 WP_000897305.1 NZ_CP127252:649362-649673 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|