283650

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 151904..152157 Replicon plasmid pKPC2_130119
Accession NZ_CP127230
Organism Klebsiella pneumoniae strain 130119

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag QRA14_RS27725 Protein ID WP_001312851.1
Coordinates 152008..152157 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 151904..151963 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRA14_RS27685 (147564) 147564..147629 - 66 Protein_199 helix-turn-helix domain-containing protein -
QRA14_RS27690 (147682) 147682..148386 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
QRA14_RS27695 (148411) 148411..148611 + 201 WP_072354025.1 hypothetical protein -
QRA14_RS27700 (148631) 148631..149377 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
QRA14_RS27705 (149432) 149432..149992 + 561 WP_000139328.1 fertility inhibition protein FinO -
QRA14_RS27710 (150124) 150124..150324 + 201 WP_015059022.1 hypothetical protein -
QRA14_RS27715 (150710) 150710..151309 + 600 WP_032083981.1 PIN domain-containing protein -
QRA14_RS27720 (151371) 151371..151703 + 333 WP_152916585.1 hypothetical protein -
- (151904) 151904..151963 - 60 NuclAT_1 - Antitoxin
- (151904) 151904..151963 - 60 NuclAT_1 - Antitoxin
- (151904) 151904..151963 - 60 NuclAT_1 - Antitoxin
- (151904) 151904..151963 - 60 NuclAT_1 - Antitoxin
QRA14_RS27725 (152008) 152008..152157 + 150 WP_001312851.1 Hok/Gef family protein Toxin
QRA14_RS27730 (152441) 152441..152689 + 249 WP_000083837.1 replication regulatory protein RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB - 1..153000 153000


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T283650 WP_001312851.1 NZ_CP127230:152008-152157 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT283650 NZ_CP127230:c151963-151904 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References