Detailed information of TA system TA283647

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 50213..50482
• Replicon: plasmid pKPC2_130119
• Accession: NZ_CP127230
• Organism: Klebsiella pneumoniae strain 130119

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QRA14_RS27010
• Protein ID: WP_001372321.1
• Coordinates: 50357..50482 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	50213..50278 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QRA14_RS26980	45923..46450	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
QRA14_RS26985	46508..46741	+	234	WP_000006003.1	DUF905 family protein	-
QRA14_RS26990	46802..48825	+	2024	Protein_60	ParB/RepB/Spo0J family partition protein	-
QRA14_RS26995	48894..49328	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QRA14_RS27000	49325..50044	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	50056..50280	+	225	NuclAT_0	-	-
-	50056..50280	+	225	NuclAT_0	-	-
-	50056..50280	+	225	NuclAT_0	-	-
-	50056..50280	+	225	NuclAT_0	-	-
-	50213..50278	-	66	-	-	Antitoxin
QRA14_RS27005	50266..50415	+	150	Protein_63	plasmid maintenance protein Mok	-
QRA14_RS27010	50357..50482	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QRA14_RS27015	50801..51097	-	297	Protein_65	hypothetical protein	-
QRA14_RS27020	51397..51693	+	297	WP_001272251.1	hypothetical protein	-
QRA14_RS27025	51804..52625	+	822	WP_001234445.1	DUF932 domain-containing protein	-
QRA14_RS27030	52922..53569	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
QRA14_RS27035	53846..54229	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QRA14_RS27040	54420..55106	+	687	WP_015059009.1	PAS domain-containing protein	-
QRA14_RS27045	55200..55427	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB	-	1..153000	153000

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T283647 WP_001372321.1 NZ_CP127230:50357-50482 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT283647 NZ_CP127230:c50278-50213 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin