Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 50213..50482 | Replicon | plasmid pKPC2_130119 |
Accession | NZ_CP127230 | ||
Organism | Klebsiella pneumoniae strain 130119 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | QRA14_RS27010 | Protein ID | WP_001372321.1 |
Coordinates | 50357..50482 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 50213..50278 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRA14_RS26980 | 45923..46450 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
QRA14_RS26985 | 46508..46741 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
QRA14_RS26990 | 46802..48825 | + | 2024 | Protein_60 | ParB/RepB/Spo0J family partition protein | - |
QRA14_RS26995 | 48894..49328 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
QRA14_RS27000 | 49325..50044 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 50056..50280 | + | 225 | NuclAT_0 | - | - |
- | 50056..50280 | + | 225 | NuclAT_0 | - | - |
- | 50056..50280 | + | 225 | NuclAT_0 | - | - |
- | 50056..50280 | + | 225 | NuclAT_0 | - | - |
- | 50213..50278 | - | 66 | - | - | Antitoxin |
QRA14_RS27005 | 50266..50415 | + | 150 | Protein_63 | plasmid maintenance protein Mok | - |
QRA14_RS27010 | 50357..50482 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
QRA14_RS27015 | 50801..51097 | - | 297 | Protein_65 | hypothetical protein | - |
QRA14_RS27020 | 51397..51693 | + | 297 | WP_001272251.1 | hypothetical protein | - |
QRA14_RS27025 | 51804..52625 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
QRA14_RS27030 | 52922..53569 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
QRA14_RS27035 | 53846..54229 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
QRA14_RS27040 | 54420..55106 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
QRA14_RS27045 | 55200..55427 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..153000 | 153000 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T283647 WP_001372321.1 NZ_CP127230:50357-50482 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT283647 NZ_CP127230:c50278-50213 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|