283638

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2632233..2632819 Replicon chromosome
Accession NZ_CP127229
Organism Klebsiella pneumoniae strain 130119

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QRA14_RS12655 Protein ID WP_002920800.1
Coordinates 2632451..2632819 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag QRA14_RS12650 Protein ID WP_002920802.1
Coordinates 2632233..2632454 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRA14_RS12630 (QRA14_12630) 2628390..2629316 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QRA14_RS12635 (QRA14_12635) 2629313..2630590 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
QRA14_RS12640 (QRA14_12640) 2630587..2631354 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QRA14_RS12645 (QRA14_12645) 2631356..2632069 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QRA14_RS12650 (QRA14_12650) 2632233..2632454 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QRA14_RS12655 (QRA14_12655) 2632451..2632819 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QRA14_RS12660 (QRA14_12660) 2633092..2634408 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QRA14_RS12665 (QRA14_12665) 2634515..2635402 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QRA14_RS12670 (QRA14_12670) 2635399..2636244 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QRA14_RS12675 (QRA14_12675) 2636246..2637316 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2629313..2638053 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T283638 WP_002920800.1 NZ_CP127229:2632451-2632819 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT283638 WP_002920802.1 NZ_CP127229:2632233-2632454 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References