Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 301335..301529 | Replicon | chromosome |
Accession | NZ_CP127177 | ||
Organism | Enterococcus faecalis strain 90_2023 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QQS48_RS01505 | Protein ID | WP_162781186.1 |
Coordinates | 301434..301529 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 301335..301399 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQS48_RS01490 (296953) | 296953..298695 | + | 1743 | WP_280196426.1 | PTS transporter subunit EIIC | - |
QQS48_RS01495 (298686) | 298686..300719 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
QQS48_RS01500 (300730) | 300730..301164 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (301335) | 301335..301399 | + | 65 | NuclAT_8 | - | Antitoxin |
QQS48_RS01505 (301434) | 301434..301529 | - | 96 | WP_162781186.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QQS48_RS01510 (301775) | 301775..303547 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
QQS48_RS01515 (303562) | 303562..303999 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QQS48_RS01520 (304014) | 304014..305168 | + | 1155 | WP_002395429.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QQS48_RS01525 (305235) | 305235..306350 | - | 1116 | WP_033785759.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3658.53 Da Isoelectric Point: 8.6635
>T283608 WP_162781186.1 NZ_CP127177:c301529-301434 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNKE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNKE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT283608 NZ_CP127177:301335-301399 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|