Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 121931..122184 Replicon plasmid pT1_p2
Accession NZ_CP127155
Organism Klebsiella pneumoniae subsp. pneumoniae strain T1

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag QP513_RS29440 Protein ID WP_001312851.1
Coordinates 122035..122184 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 121931..121990 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP513_RS29400 (117313) 117313..117657 - 345 Protein_161 IS6-like element IS26 family transposase -
QP513_RS29405 (117709) 117709..118413 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
QP513_RS29410 (118438) 118438..118638 + 201 WP_072354025.1 hypothetical protein -
QP513_RS29415 (118658) 118658..119404 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
QP513_RS29420 (119459) 119459..120019 + 561 WP_000139328.1 fertility inhibition protein FinO -
QP513_RS29425 (120151) 120151..120351 + 201 WP_015059022.1 hypothetical protein -
QP513_RS29430 (120737) 120737..121336 + 600 WP_032083981.1 PIN domain-containing protein -
QP513_RS29435 (121398) 121398..121730 + 333 WP_152916585.1 hypothetical protein -
- (121931) 121931..121990 - 60 NuclAT_1 - Antitoxin
- (121931) 121931..121990 - 60 NuclAT_1 - Antitoxin
- (121931) 121931..121990 - 60 NuclAT_1 - Antitoxin
- (121931) 121931..121990 - 60 NuclAT_1 - Antitoxin
QP513_RS29440 (122035) 122035..122184 + 150 WP_001312851.1 Hok/Gef family protein Toxin
QP513_RS29445 (122468) 122468..122716 + 249 WP_000083837.1 replication regulatory protein RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-65 / rmtB / blaTEM-1B / blaSHV-12 / blaKPC-2 - 1..123027 123027


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T283597 WP_001312851.1 NZ_CP127155:122035-122184 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT283597 NZ_CP127155:c121990-121931 [Klebsiella pneumoniae subsp. pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References