Detailed information of TA system TA283594

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 30941..31210
• Replicon: plasmid pT1_p2
• Accession: NZ_CP127155
• Organism: Klebsiella pneumoniae subsp. pneumoniae strain T1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QP513_RS28800
• Protein ID: WP_001372321.1
• Coordinates: 31085..31210 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	30941..31006 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QP513_RS28770	26651..27178	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
QP513_RS28775	27236..27469	+	234	WP_000006003.1	DUF905 family protein	-
QP513_RS28780	27530..29553	+	2024	Protein_37	ParB/RepB/Spo0J family partition protein	-
QP513_RS28785	29622..30056	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QP513_RS28790	30053..30772	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	30784..31008	+	225	NuclAT_0	-	-
-	30784..31008	+	225	NuclAT_0	-	-
-	30784..31008	+	225	NuclAT_0	-	-
-	30784..31008	+	225	NuclAT_0	-	-
-	30941..31006	-	66	-	-	Antitoxin
QP513_RS28795	30994..31143	+	150	Protein_40	plasmid maintenance protein Mok	-
QP513_RS28800	31085..31210	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QP513_RS28805	31529..31825	-	297	Protein_42	hypothetical protein	-
QP513_RS28810	32125..32421	+	297	WP_001272251.1	hypothetical protein	-
QP513_RS28815	32532..33353	+	822	WP_001234445.1	DUF932 domain-containing protein	-
QP513_RS28820	33650..34297	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
QP513_RS28825	34574..34957	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QP513_RS28830	35148..35834	+	687	WP_015059009.1	PAS domain-containing protein	-
QP513_RS28835	35928..36155	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaCTX-M-65 / rmtB / blaTEM-1B / blaSHV-12 / blaKPC-2	-	1..123027	123027

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T283594 WP_001372321.1 NZ_CP127155:31085-31210 [Klebsiella pneumoniae subsp. pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT283594 NZ_CP127155:c31006-30941 [Klebsiella pneumoniae subsp. pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin