Detailed information of TA system TA283593

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 30784..31210
• Replicon: plasmid pT1_p2
• Accession: NZ_CP127155
• Organism: Klebsiella pneumoniae subsp. pneumoniae strain T1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QP513_RS28800
• Protein ID: WP_001372321.1
• Coordinates: 31085..31210 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	30784..31008 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QP513_RS28765 (25894)	25894..26349	-	456	Protein_34	hypothetical protein	-
QP513_RS28770 (26651)	26651..27178	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
QP513_RS28775 (27236)	27236..27469	+	234	WP_000006003.1	DUF905 family protein	-
QP513_RS28780 (27530)	27530..29553	+	2024	Protein_37	ParB/RepB/Spo0J family partition protein	-
QP513_RS28785 (29622)	29622..30056	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QP513_RS28790 (30053)	30053..30772	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
- (30784)	30784..31008	+	225	NuclAT_0	-	Antitoxin
- (30784)	30784..31008	+	225	NuclAT_0	-	Antitoxin
- (30784)	30784..31008	+	225	NuclAT_0	-	Antitoxin
- (30784)	30784..31008	+	225	NuclAT_0	-	Antitoxin
QP513_RS28795 (30994)	30994..31143	+	150	Protein_40	plasmid maintenance protein Mok	-
QP513_RS28800 (31085)	31085..31210	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QP513_RS28805 (31529)	31529..31825	-	297	Protein_42	hypothetical protein	-
QP513_RS28810 (32125)	32125..32421	+	297	WP_001272251.1	hypothetical protein	-
QP513_RS28815 (32532)	32532..33353	+	822	WP_001234445.1	DUF932 domain-containing protein	-
QP513_RS28820 (33650)	33650..34297	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
QP513_RS28825 (34574)	34574..34957	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QP513_RS28830 (35148)	35148..35834	+	687	WP_015059009.1	PAS domain-containing protein	-
QP513_RS28835 (35928)	35928..36155	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaCTX-M-65 / rmtB / blaTEM-1B / blaSHV-12 / blaKPC-2	-	1..123027	123027

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T283593 WP_001372321.1 NZ_CP127155:31085-31210 [Klebsiella pneumoniae subsp. pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT283593 NZ_CP127155:30784-31008 [Klebsiella pneumoniae subsp. pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin