Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 104828..105555 | Replicon | plasmid pT1_p1 |
| Accession | NZ_CP127154 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain T1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | QP513_RS28010 | Protein ID | WP_011251285.1 |
| Coordinates | 104828..105139 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QP513_RS28015 | Protein ID | WP_011251286.1 |
| Coordinates | 105136..105555 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QP513_RS27970 (QP513_27970) | 99839..100333 | + | 495 | WP_011251274.1 | hypothetical protein | - |
| QP513_RS27975 (QP513_27975) | 100339..100779 | + | 441 | WP_011251275.1 | hypothetical protein | - |
| QP513_RS27980 (QP513_27980) | 101204..102160 | - | 957 | WP_011251280.1 | DsbA family protein | - |
| QP513_RS27985 (QP513_27985) | 102220..102561 | - | 342 | WP_011251281.1 | hypothetical protein | - |
| QP513_RS27990 (QP513_27990) | 102575..102886 | - | 312 | WP_011251282.1 | hypothetical protein | - |
| QP513_RS27995 (QP513_27995) | 102903..103352 | - | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| QP513_RS28005 (QP513_28005) | 104186..104623 | + | 438 | Protein_123 | DDE-type integrase/transposase/recombinase | - |
| QP513_RS28010 (QP513_28010) | 104828..105139 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QP513_RS28015 (QP513_28015) | 105136..105555 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QP513_RS28020 (QP513_28020) | 105702..106670 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| QP513_RS28025 (QP513_28025) | 106742..107107 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| QP513_RS28030 (QP513_28030) | 107121..107909 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| QP513_RS28035 (QP513_28035) | 107930..108550 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| QP513_RS28040 (QP513_28040) | 108969..109604 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| QP513_RS28045 (QP513_28045) | 109917..110387 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / iroN | 1..221844 | 221844 | |
| - | inside | IScluster/Tn | - | - | 97919..122226 | 24307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T283592 WP_011251285.1 NZ_CP127154:104828-105139 [Klebsiella pneumoniae subsp. pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT283592 WP_011251286.1 NZ_CP127154:105136-105555 [Klebsiella pneumoniae subsp. pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|