Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 104828..105555 Replicon plasmid pT1_p1
Accession NZ_CP127154
Organism Klebsiella pneumoniae subsp. pneumoniae strain T1

Toxin (Protein)


Gene name higB Uniprot ID A0A7W3D9W1
Locus tag QP513_RS28010 Protein ID WP_011251285.1
Coordinates 104828..105139 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QP513_RS28015 Protein ID WP_011251286.1
Coordinates 105136..105555 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP513_RS27970 (QP513_27970) 99839..100333 + 495 WP_011251274.1 hypothetical protein -
QP513_RS27975 (QP513_27975) 100339..100779 + 441 WP_011251275.1 hypothetical protein -
QP513_RS27980 (QP513_27980) 101204..102160 - 957 WP_011251280.1 DsbA family protein -
QP513_RS27985 (QP513_27985) 102220..102561 - 342 WP_011251281.1 hypothetical protein -
QP513_RS27990 (QP513_27990) 102575..102886 - 312 WP_011251282.1 hypothetical protein -
QP513_RS27995 (QP513_27995) 102903..103352 - 450 WP_011251283.1 thioredoxin fold domain-containing protein -
QP513_RS28005 (QP513_28005) 104186..104623 + 438 Protein_123 DDE-type integrase/transposase/recombinase -
QP513_RS28010 (QP513_28010) 104828..105139 + 312 WP_011251285.1 type II toxin-antitoxin system HigB family toxin Toxin
QP513_RS28015 (QP513_28015) 105136..105555 + 420 WP_011251286.1 helix-turn-helix domain-containing protein Antitoxin
QP513_RS28020 (QP513_28020) 105702..106670 + 969 WP_074428168.1 IS5 family transposase -
QP513_RS28025 (QP513_28025) 106742..107107 - 366 WP_048333448.1 hypothetical protein -
QP513_RS28030 (QP513_28030) 107121..107909 - 789 WP_040217257.1 hypothetical protein -
QP513_RS28035 (QP513_28035) 107930..108550 - 621 WP_223175004.1 conjugative transfer protein MobI(A/C) -
QP513_RS28040 (QP513_28040) 108969..109604 + 636 WP_223171879.1 hypothetical protein -
QP513_RS28045 (QP513_28045) 109917..110387 + 471 WP_048333570.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / iroN 1..221844 221844
- inside IScluster/Tn - - 97919..122226 24307


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(22-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(85-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12346.12 Da        Isoelectric Point: 9.7248

>T283592 WP_011251285.1 NZ_CP127154:104828-105139 [Klebsiella pneumoniae subsp. pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15377.46 Da        Isoelectric Point: 4.4420

>AT283592 WP_011251286.1 NZ_CP127154:105136-105555 [Klebsiella pneumoniae subsp. pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W3D9W1

Antitoxin

Source ID Structure

References