Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 740687..741462 | Replicon | chromosome |
Accession | NZ_CP127153 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain T1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | QP513_RS03700 | Protein ID | WP_004150910.1 |
Coordinates | 740977..741462 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | QP513_RS03695 | Protein ID | WP_004150912.1 |
Coordinates | 740687..740980 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QP513_RS03675 (QP513_03675) | 735895..736497 | - | 603 | WP_062954968.1 | short chain dehydrogenase | - |
QP513_RS03680 (QP513_03680) | 736595..737506 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
QP513_RS03685 (QP513_03685) | 737507..738655 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
QP513_RS03690 (QP513_03690) | 738666..740042 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
QP513_RS03695 (QP513_03695) | 740687..740980 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
QP513_RS03700 (QP513_03700) | 740977..741462 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
QP513_RS03705 (QP513_03705) | 742166..742759 | + | 594 | WP_004188553.1 | hypothetical protein | - |
QP513_RS03710 (QP513_03710) | 742856..743072 | + | 217 | Protein_729 | transposase | - |
QP513_RS03715 (QP513_03715) | 743678..744550 | + | 873 | WP_004188557.1 | ParA family protein | - |
QP513_RS03720 (QP513_03720) | 744550..744933 | + | 384 | WP_004150906.1 | hypothetical protein | - |
QP513_RS03725 (QP513_03725) | 744926..746293 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 742856..743008 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T283578 WP_004150910.1 NZ_CP127153:740977-741462 [Klebsiella pneumoniae subsp. pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |