Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 327271..327857 Replicon chromosome
Accession NZ_CP127153
Organism Klebsiella pneumoniae subsp. pneumoniae strain T1

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QP513_RS01520 Protein ID WP_002920800.1
Coordinates 327489..327857 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag QP513_RS01515 Protein ID WP_002920802.1
Coordinates 327271..327492 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QP513_RS01495 (QP513_01495) 323428..324354 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QP513_RS01500 (QP513_01500) 324351..325628 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
QP513_RS01505 (QP513_01505) 325625..326392 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QP513_RS01510 (QP513_01510) 326394..327107 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QP513_RS01515 (QP513_01515) 327271..327492 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QP513_RS01520 (QP513_01520) 327489..327857 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QP513_RS01525 (QP513_01525) 328130..329446 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QP513_RS01530 (QP513_01530) 329553..330440 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QP513_RS01535 (QP513_01535) 330437..331282 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QP513_RS01540 (QP513_01540) 331284..332354 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 324351..333091 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T283576 WP_002920800.1 NZ_CP127153:327489-327857 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT283576 WP_002920802.1 NZ_CP127153:327271-327492 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References