Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
| Location | 231676..232199 | Replicon | chromosome |
| Accession | NZ_CP127101 | ||
| Organism | Staphylococcus pseudintermedius strain 10916-77753 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | A0A8H9EQJ3 |
| Locus tag | QQZ06_RS01030 | Protein ID | WP_014612815.1 |
| Coordinates | 231933..232199 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | A0A3D8YKM0 |
| Locus tag | QQZ06_RS01025 | Protein ID | WP_014612814.1 |
| Coordinates | 231676..231933 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQZ06_RS01015 (QQZ06_01015) | 228824..229318 | - | 495 | WP_015729749.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
| QQZ06_RS01020 (QQZ06_01020) | 229578..231482 | + | 1905 | WP_214561763.1 | triacylglycerol lipase | - |
| QQZ06_RS01025 (QQZ06_01025) | 231676..231933 | + | 258 | WP_014612814.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQZ06_RS01030 (QQZ06_01030) | 231933..232199 | + | 267 | WP_014612815.1 | Txe/YoeB family addiction module toxin | Toxin |
| QQZ06_RS01035 (QQZ06_01035) | 232560..232661 | - | 102 | WP_019169745.1 | SE2200 family small protein | - |
| QQZ06_RS01040 (QQZ06_01040) | 232675..234168 | - | 1494 | WP_014612817.1 | L-lactate dehydrogenase (quinone) | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10555.15 Da Isoelectric Point: 10.2281
>T283563 WP_014612815.1 NZ_CP127101:231933-232199 [Staphylococcus pseudintermedius]
MGNYSVLIKNSAKNDLKKIKKSLLKEQFSKIIEVLKINPYEASQSFEKLQPKHSARYLRRLNHQHRVVYTVDDEKREVYI
FSAWSHYE
MGNYSVLIKNSAKNDLKKIKKSLLKEQFSKIIEVLKINPYEASQSFEKLQPKHSARYLRRLNHQHRVVYTVDDEKREVYI
FSAWSHYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|