Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
| Location | 227490..228013 | Replicon | chromosome |
| Accession | NZ_CP127100 | ||
| Organism | Staphylococcus pseudintermedius strain 6127-64107 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | A0A317Z6J3 |
| Locus tag | QQZ05_RS01015 | Protein ID | WP_037542127.1 |
| Coordinates | 227747..228013 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | A0A2P5PI69 |
| Locus tag | QQZ05_RS01010 | Protein ID | WP_015729747.1 |
| Coordinates | 227490..227747 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQZ05_RS00995 (QQZ05_00995) | 223538..224326 | + | 789 | WP_063284837.1 | arylamine N-acetyltransferase | - |
| QQZ05_RS01000 (QQZ05_01000) | 224638..225132 | - | 495 | WP_015729749.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
| QQZ05_RS01005 (QQZ05_01005) | 225392..227296 | + | 1905 | WP_285534310.1 | triacylglycerol lipase | - |
| QQZ05_RS01010 (QQZ05_01010) | 227490..227747 | + | 258 | WP_015729747.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQZ05_RS01015 (QQZ05_01015) | 227747..228013 | + | 267 | WP_037542127.1 | Txe/YoeB family addiction module toxin | Toxin |
| QQZ05_RS01020 (QQZ05_01020) | 228364..228465 | - | 102 | WP_019169745.1 | SE2200 family small protein | - |
| QQZ05_RS01025 (QQZ05_01025) | 228479..229972 | - | 1494 | WP_014612817.1 | L-lactate dehydrogenase (quinone) | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10555.10 Da Isoelectric Point: 10.1602
>T283560 WP_037542127.1 NZ_CP127100:227747-228013 [Staphylococcus pseudintermedius]
MGNYSVLIKNSAKNDLKKIKKSLLKEQFSKIIEVLKINPYEASQSFEKLQPKHSARYSRRLNHQHRVVYTVDDEKREVYI
FSAWSYYE
MGNYSVLIKNSAKNDLKKIKKSLLKEQFSKIIEVLKINPYEASQSFEKLQPKHSARYSRRLNHQHRVVYTVDDEKREVYI
FSAWSYYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A317Z6J3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P5PI69 |