Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 247114..247637 | Replicon | chromosome |
Accession | NZ_CP127094 | ||
Organism | Staphylococcus pseudintermedius strain 19KM0990 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A8H9EQJ3 |
Locus tag | QQO15_RS01095 | Protein ID | WP_014612815.1 |
Coordinates | 247371..247637 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A3D8YKM0 |
Locus tag | QQO15_RS01090 | Protein ID | WP_014612814.1 |
Coordinates | 247114..247371 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQO15_RS01075 (QQO15_01075) | 243162..243968 | + | 807 | WP_140237858.1 | arylamine N-acetyltransferase | - |
QQO15_RS01080 (QQO15_01080) | 244262..244756 | - | 495 | WP_037542124.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
QQO15_RS01085 (QQO15_01085) | 245016..246920 | + | 1905 | WP_190320772.1 | triacylglycerol lipase | - |
QQO15_RS01090 (QQO15_01090) | 247114..247371 | + | 258 | WP_014612814.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QQO15_RS01095 (QQO15_01095) | 247371..247637 | + | 267 | WP_014612815.1 | Txe/YoeB family addiction module toxin | Toxin |
QQO15_RS01100 (QQO15_01100) | 247981..248082 | - | 102 | WP_019169745.1 | SE2200 family small protein | - |
QQO15_RS01105 (QQO15_01105) | 248096..249589 | - | 1494 | WP_014612817.1 | L-lactate dehydrogenase (quinone) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10555.15 Da Isoelectric Point: 10.2281
>T283550 WP_014612815.1 NZ_CP127094:247371-247637 [Staphylococcus pseudintermedius]
MGNYSVLIKNSAKNDLKKIKKSLLKEQFSKIIEVLKINPYEASQSFEKLQPKHSARYLRRLNHQHRVVYTVDDEKREVYI
FSAWSHYE
MGNYSVLIKNSAKNDLKKIKKSLLKEQFSKIIEVLKINPYEASQSFEKLQPKHSARYLRRLNHQHRVVYTVDDEKREVYI
FSAWSHYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|